BLASTX nr result
ID: Jatropha_contig00012807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012807 (167 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516569.1| Coiled-coil domain-containing protein, putat... 68 1e-09 ref|XP_002324816.1| predicted protein [Populus trichocarpa] 65 7e-09 gb|ESR63871.1| hypothetical protein CICLE_v10009455mg [Citrus cl... 65 1e-08 gb|ERM98592.1| hypothetical protein AMTR_s00109p00055760 [Ambore... 65 1e-08 emb|CBI20890.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002284173.1| PREDICTED: coiled-coil domain-containing pro... 65 1e-08 ref|XP_002309559.1| predicted protein [Populus trichocarpa] gi|2... 65 1e-08 emb|CAN72066.1| hypothetical protein VITISV_042589 [Vitis vinifera] 65 1e-08 gb|EMJ24618.1| hypothetical protein PRUPE_ppa011315mg [Prunus pe... 63 3e-08 gb|EOY29676.1| Uncharacterized protein TCM_037150 [Theobroma cacao] 62 6e-08 ref|XP_004291205.1| PREDICTED: coiled-coil domain-containing pro... 61 1e-07 ref|XP_004960640.1| PREDICTED: coiled-coil domain-containing pro... 61 2e-07 ref|XP_004168636.1| PREDICTED: coiled-coil domain-containing pro... 61 2e-07 ref|XP_004136294.1| PREDICTED: coiled-coil domain-containing pro... 61 2e-07 gb|AFW82081.1| hypothetical protein ZEAMMB73_801243, partial [Ze... 61 2e-07 ref|XP_002440815.1| hypothetical protein SORBIDRAFT_09g007310 [S... 61 2e-07 gb|ACR35873.1| unknown [Zea mays] gi|413949433|gb|AFW82082.1| hy... 61 2e-07 ref|NP_001150110.1| LOC100283739 [Zea mays] gi|194707814|gb|ACF8... 61 2e-07 gb|ESQ41109.1| hypothetical protein EUTSA_v10014652mg [Eutrema s... 60 4e-07 ref|XP_006288641.1| hypothetical protein CARUB_v10001946mg [Caps... 60 4e-07 >ref|XP_002516569.1| Coiled-coil domain-containing protein, putative [Ricinus communis] gi|223544389|gb|EEF45910.1| Coiled-coil domain-containing protein, putative [Ricinus communis] Length = 215 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM Sbjct: 182 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 215 >ref|XP_002324816.1| predicted protein [Populus trichocarpa] Length = 216 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMV+EKMTSNKQ+ASENKSLQELE+DFM Sbjct: 183 IRSYKGLMVAEKMTSNKQVASENKSLQELEDDFM 216 >gb|ESR63871.1| hypothetical protein CICLE_v10009455mg [Citrus clementina] Length = 215 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 +RSYKGLMV+EKMTSNKQIASE+KSLQELEEDFM Sbjct: 182 VRSYKGLMVAEKMTSNKQIASESKSLQELEEDFM 215 >gb|ERM98592.1| hypothetical protein AMTR_s00109p00055760 [Amborella trichopoda] Length = 215 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMVS+KMTSNKQIAS NKSLQELEEDFM Sbjct: 182 IRSYKGLMVSDKMTSNKQIASTNKSLQELEEDFM 215 >emb|CBI20890.3| unnamed protein product [Vitis vinifera] Length = 198 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMVSEKMTSNKQIAS NKSLQELE+DFM Sbjct: 165 IRSYKGLMVSEKMTSNKQIASANKSLQELEDDFM 198 >ref|XP_002284173.1| PREDICTED: coiled-coil domain-containing protein 25-like [Vitis vinifera] Length = 215 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMVSEKMTSNKQIAS NKSLQELE+DFM Sbjct: 182 IRSYKGLMVSEKMTSNKQIASANKSLQELEDDFM 215 >ref|XP_002309559.1| predicted protein [Populus trichocarpa] gi|222855535|gb|EEE93082.1| hypothetical protein POPTR_0006s25860g [Populus trichocarpa] Length = 215 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 +RSYKGLMV+EKMTSNKQIASENKSLQELE+DFM Sbjct: 182 MRSYKGLMVAEKMTSNKQIASENKSLQELEDDFM 215 >emb|CAN72066.1| hypothetical protein VITISV_042589 [Vitis vinifera] Length = 199 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMVSEKMTSNKQIAS NKSLQELE+DFM Sbjct: 166 IRSYKGLMVSEKMTSNKQIASANKSLQELEDDFM 199 >gb|EMJ24618.1| hypothetical protein PRUPE_ppa011315mg [Prunus persica] Length = 215 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 +RSYKGLMVSE MTSNKQIAS NKSLQELEEDFM Sbjct: 182 LRSYKGLMVSENMTSNKQIASANKSLQELEEDFM 215 >gb|EOY29676.1| Uncharacterized protein TCM_037150 [Theobroma cacao] Length = 215 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMVSEKMTSNKQIA +KSLQELEEDFM Sbjct: 182 IRSYKGLMVSEKMTSNKQIAETSKSLQELEEDFM 215 >ref|XP_004291205.1| PREDICTED: coiled-coil domain-containing protein 25-like [Fragaria vesca subsp. vesca] Length = 215 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 +RSYKGLMV E MTSNKQIAS NKSLQELEEDFM Sbjct: 182 LRSYKGLMVHENMTSNKQIASANKSLQELEEDFM 215 >ref|XP_004960640.1| PREDICTED: coiled-coil domain-containing protein 25-like [Setaria italica] Length = 215 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 182 IRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 215 >ref|XP_004168636.1| PREDICTED: coiled-coil domain-containing protein 25-like [Cucumis sativus] Length = 215 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 +RSYKGLMVSEKMTSNKQIA+ +KSLQELE+DFM Sbjct: 182 LRSYKGLMVSEKMTSNKQIAATSKSLQELEDDFM 215 >ref|XP_004136294.1| PREDICTED: coiled-coil domain-containing protein 25-like [Cucumis sativus] Length = 215 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 +RSYKGLMVSEKMTSNKQIA+ +KSLQELE+DFM Sbjct: 182 LRSYKGLMVSEKMTSNKQIAATSKSLQELEDDFM 215 >gb|AFW82081.1| hypothetical protein ZEAMMB73_801243, partial [Zea mays] Length = 106 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 73 IRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 106 >ref|XP_002440815.1| hypothetical protein SORBIDRAFT_09g007310 [Sorghum bicolor] gi|241946100|gb|EES19245.1| hypothetical protein SORBIDRAFT_09g007310 [Sorghum bicolor] Length = 215 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 182 IRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 215 >gb|ACR35873.1| unknown [Zea mays] gi|413949433|gb|AFW82082.1| hypothetical protein ZEAMMB73_801243 [Zea mays] Length = 113 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 80 IRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 113 >ref|NP_001150110.1| LOC100283739 [Zea mays] gi|194707814|gb|ACF87991.1| unknown [Zea mays] gi|195627538|gb|ACG35599.1| coiled-coil domain-containing protein 25 [Zea mays] gi|195636814|gb|ACG37875.1| coiled-coil domain-containing protein 25 [Zea mays] gi|413949437|gb|AFW82086.1| coiled-coil domain-containing protein 25 [Zea mays] Length = 215 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 IRSYKGLMV EKMTSNKQIAS +K+LQELEEDFM Sbjct: 182 IRSYKGLMVQEKMTSNKQIASGSKTLQELEEDFM 215 >gb|ESQ41109.1| hypothetical protein EUTSA_v10014652mg [Eutrema salsugineum] Length = 215 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 +RSYKGLMV++KMTSNK IAS NKSLQELE+DFM Sbjct: 182 MRSYKGLMVTDKMTSNKDIASSNKSLQELEDDFM 215 >ref|XP_006288641.1| hypothetical protein CARUB_v10001946mg [Capsella rubella] gi|482557347|gb|EOA21539.1| hypothetical protein CARUB_v10001946mg [Capsella rubella] Length = 215 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 48 IRSYKGLMVSEKMTSNKQIASENKSLQELEEDFM 149 +RSYKGLMV++KMTSNK IAS NKSLQELE+DFM Sbjct: 182 MRSYKGLMVTDKMTSNKDIASSNKSLQELEDDFM 215