BLASTX nr result
ID: Jatropha_contig00012758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012758 (483 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522225.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002522225.1| conserved hypothetical protein [Ricinus communis] gi|223538478|gb|EEF40083.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/50 (58%), Positives = 29/50 (58%) Frame = -3 Query: 478 DEEWMXXXXXXXXXXXXXXXXXXXXDAEDSNQETQQVDGDTWHDLALGNQ 329 DEEWM DAEDSNQETQQVDGDTW DLALGNQ Sbjct: 14 DEEWMRDTLPDDDLPLPPVLVVRTDDAEDSNQETQQVDGDTWRDLALGNQ 63