BLASTX nr result
ID: Jatropha_contig00012686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012686 (416 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR46648.1| hypothetical protein CICLE_v10002897mg [Citrus cl... 40 4e-06 >gb|ESR46648.1| hypothetical protein CICLE_v10002897mg [Citrus clementina] Length = 112 Score = 40.4 bits (93), Expect(2) = 4e-06 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = -2 Query: 289 VPCSRRGAFLLQFAEQELRPNPYSRGCNRITRCR 188 VPCSRRGA + + NPY+RGC+ ITRCR Sbjct: 79 VPCSRRGASYYN-CQNGGQANPYNRGCSAITRCR 111 Score = 35.8 bits (81), Expect(2) = 4e-06 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 356 EINRRILATRTNISYGALRRNS 291 EINRRILAT ISYGAL+RN+ Sbjct: 57 EINRRILATNKYISYGALQRNT 78