BLASTX nr result
ID: Jatropha_contig00012670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012670 (610 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM97668.1| hypothetical protein AMTR_s00130p00095330 [Ambore... 99 7e-19 >gb|ERM97668.1| hypothetical protein AMTR_s00130p00095330 [Amborella trichopoda] Length = 72 Score = 99.4 bits (246), Expect = 7e-19 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -2 Query: 165 MGIANDKEIFPLMSSKVNEDKGKHQFICSWESEE*DFYQYGPTRLKTLGSRQKKK 1 MGIANDKEI+P+MSSKV EDKGKHQFICSWESEE DFYQY PTRL TLGS+ +KK Sbjct: 1 MGIANDKEIYPMMSSKVIEDKGKHQFICSWESEENDFYQYKPTRLNTLGSKLRKK 55