BLASTX nr result
ID: Jatropha_contig00012627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012627 (135 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor,... 65 9e-09 >ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] gi|223527043|gb|EEF29229.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] Length = 410 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +1 Query: 1 SKGPRTEMLRKVNRSSGNGPKYRKRSTNEICDGKAASCPRQSVSP 135 S+G R E LRKVNR+S NGP+Y ++ST E CDGKAAS PR S SP Sbjct: 363 SRGSRHESLRKVNRNSNNGPRYHRKSTAETCDGKAASYPRPSASP 407