BLASTX nr result
ID: Jatropha_contig00012560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012560 (351 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519434.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 >ref|XP_002519434.1| conserved hypothetical protein [Ricinus communis] gi|223541297|gb|EEF42848.1| conserved hypothetical protein [Ricinus communis] Length = 229 Score = 63.2 bits (152), Expect = 3e-08 Identities = 35/67 (52%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = +3 Query: 153 SQEEQAQPRPGEAPT-QSWYXXXXXXXXXXXXXXXXXXXXXXXYGLQQAQSPSHVSPAEA 329 SQE+Q QPRP + P QSWY YGLQ+ QSPSHVSPAEA Sbjct: 7 SQEQQGQPRPQDVPAPQSWYPSSVVSSPNSSRPTTPSSSSSSSYGLQRPQSPSHVSPAEA 66 Query: 330 AGVIALL 350 AGVIALL Sbjct: 67 AGVIALL 73