BLASTX nr result
ID: Jatropha_contig00012543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012543 (166 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523219.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_002523219.1| conserved hypothetical protein [Ricinus communis] gi|223537515|gb|EEF39140.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = -1 Query: 160 LYKALLNPNMIYTGVRISGDAKKLSKDYDLEISFIADIPDLSA 32 LY+AL NPN+IYT VRISG+AKKL KDYDLE++ +A++ DL+A Sbjct: 65 LYQALANPNIIYTRVRISGNAKKLEKDYDLEVTHMANVADLAA 107