BLASTX nr result
ID: Jatropha_contig00012496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012496 (198 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW33880.1| RING-H2 subgroup RHE protein [Populus tremula x P... 84 2e-14 gb|ERP64643.1| zinc finger family protein [Populus trichocarpa] 82 5e-14 ref|XP_002328624.1| predicted protein [Populus trichocarpa] 82 5e-14 ref|XP_002516957.1| ring finger protein, putative [Ricinus commu... 80 3e-13 gb|EEF01679.2| hypothetical protein POPTR_0010s01400g [Populus t... 75 1e-11 ref|XP_002315508.1| predicted protein [Populus trichocarpa] 75 1e-11 ref|XP_002271292.1| PREDICTED: RING-H2 finger protein ATL2-like ... 68 1e-09 ref|XP_002271253.1| PREDICTED: RING-H2 finger protein ATL2-like ... 68 1e-09 >gb|AAW33880.1| RING-H2 subgroup RHE protein [Populus tremula x Populus alba] Length = 293 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/62 (64%), Positives = 47/62 (75%), Gaps = 1/62 (1%) Frame = +3 Query: 9 SGLCATCQHNEDHVG-ASNSSYGGRRKPAELLGVTIEVPRRNGNFEDESAIESPEYQVAY 185 SGLC +CQH EDH+G AS SS+ G RKP L+GVTI+VPRRNGNFEDES ESP ++ Sbjct: 177 SGLCTSCQHEEDHLGSASTSSFNGGRKPVGLIGVTIDVPRRNGNFEDESNTESPSASHSF 236 Query: 186 ES 191 S Sbjct: 237 RS 238 >gb|ERP64643.1| zinc finger family protein [Populus trichocarpa] Length = 293 Score = 82.4 bits (202), Expect = 5e-14 Identities = 40/62 (64%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Frame = +3 Query: 9 SGLCATCQHNEDHVG-ASNSSYGGRRKPAELLGVTIEVPRRNGNFEDESAIESPEYQVAY 185 SGLC +CQH EDHVG AS SS+ RKP L+GVTI+VPRRNGNFEDES ESP ++ Sbjct: 177 SGLCTSCQHEEDHVGSASTSSFNDGRKPVGLIGVTIDVPRRNGNFEDESNTESPSASHSF 236 Query: 186 ES 191 S Sbjct: 237 RS 238 >ref|XP_002328624.1| predicted protein [Populus trichocarpa] Length = 293 Score = 82.4 bits (202), Expect = 5e-14 Identities = 40/62 (64%), Positives = 46/62 (74%), Gaps = 1/62 (1%) Frame = +3 Query: 9 SGLCATCQHNEDHVG-ASNSSYGGRRKPAELLGVTIEVPRRNGNFEDESAIESPEYQVAY 185 SGLC +CQH EDHVG AS SS+ RKP L+GVTI+VPRRNGNFEDES ESP ++ Sbjct: 177 SGLCTSCQHEEDHVGSASTSSFNDGRKPVGLIGVTIDVPRRNGNFEDESNTESPSASHSF 236 Query: 186 ES 191 S Sbjct: 237 RS 238 >ref|XP_002516957.1| ring finger protein, putative [Ricinus communis] gi|223544045|gb|EEF45571.1| ring finger protein, putative [Ricinus communis] Length = 292 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/57 (70%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = +3 Query: 3 SDSGLCATCQHNEDHVG--ASNSSYGGRRKPAELLGVTIEVPRRNGNFEDESAIESP 167 S +GLC TCQH E+ V AS SS+ GRRKPAE +GVTIEVPRRNG FEDE A ESP Sbjct: 175 SRAGLCVTCQHEENRVDGVASTSSFNGRRKPAEFVGVTIEVPRRNGVFEDEPATESP 231 >gb|EEF01679.2| hypothetical protein POPTR_0010s01400g [Populus trichocarpa] Length = 291 Score = 74.7 bits (182), Expect = 1e-11 Identities = 40/64 (62%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +3 Query: 3 SDSGLCATCQHNEDHVG-ASNSSYGGRRKPAELLGVTIEVPRRNGNFEDESAIESPEYQV 179 S S CQH ED VG AS SS+ RRK EL+GVTIEVPRRNGNFEDES ESP Sbjct: 177 SGSSSGTMCQHEEDRVGSASTSSFNDRRKQMELIGVTIEVPRRNGNFEDESNTESPSASH 236 Query: 180 AYES 191 A+ S Sbjct: 237 AFRS 240 >ref|XP_002315508.1| predicted protein [Populus trichocarpa] Length = 273 Score = 74.7 bits (182), Expect = 1e-11 Identities = 40/64 (62%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +3 Query: 3 SDSGLCATCQHNEDHVG-ASNSSYGGRRKPAELLGVTIEVPRRNGNFEDESAIESPEYQV 179 S S CQH ED VG AS SS+ RRK EL+GVTIEVPRRNGNFEDES ESP Sbjct: 162 SGSSSGTMCQHEEDRVGSASTSSFNDRRKQMELIGVTIEVPRRNGNFEDESNTESPSASH 221 Query: 180 AYES 191 A+ S Sbjct: 222 AFRS 225 >ref|XP_002271292.1| PREDICTED: RING-H2 finger protein ATL2-like isoform 2 [Vitis vinifera] Length = 320 Score = 67.8 bits (164), Expect = 1e-09 Identities = 37/69 (53%), Positives = 45/69 (65%), Gaps = 10/69 (14%) Frame = +3 Query: 3 SDSGLCATCQHNEDHVG-------ASNSSYGGRRKPAELLGVTIEVPRRNGNF---EDES 152 S S LC+TCQH+ED G +SS G RRK +EL GV+IEVPRRN NF EDES Sbjct: 187 STSALCSTCQHDEDRTGRLRTSSSVGSSSVGSRRKSSELAGVSIEVPRRNENFGLSEDES 246 Query: 153 AIESPEYQV 179 ++SP +V Sbjct: 247 LLDSPATRV 255 >ref|XP_002271253.1| PREDICTED: RING-H2 finger protein ATL2-like isoform 1 [Vitis vinifera] Length = 317 Score = 67.8 bits (164), Expect = 1e-09 Identities = 37/69 (53%), Positives = 45/69 (65%), Gaps = 10/69 (14%) Frame = +3 Query: 3 SDSGLCATCQHNEDHVG-------ASNSSYGGRRKPAELLGVTIEVPRRNGNF---EDES 152 S S LC+TCQH+ED G +SS G RRK +EL GV+IEVPRRN NF EDES Sbjct: 184 STSALCSTCQHDEDRTGRLRTSSSVGSSSVGSRRKSSELAGVSIEVPRRNENFGLSEDES 243 Query: 153 AIESPEYQV 179 ++SP +V Sbjct: 244 LLDSPATRV 252