BLASTX nr result
ID: Jatropha_contig00012359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012359 (303 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM97878.1| hypothetical protein AMTR_s00115p00112450 [Ambore... 88 1e-15 ref|XP_002516402.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002515778.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 60 4e-07 >gb|ERM97878.1| hypothetical protein AMTR_s00115p00112450 [Amborella trichopoda] Length = 61 Score = 87.8 bits (216), Expect = 1e-15 Identities = 44/52 (84%), Positives = 45/52 (86%) Frame = +2 Query: 116 ESEGKRGQSSARSSNSLQQTGMVL*SKQLRHFRVPIGRQPFRGFLRDRFTLR 271 ESEGKRGQ ARSSNS QQTGMV SKQL H RVPIGRQPF+GFLRDRFTLR Sbjct: 2 ESEGKRGQPMARSSNSFQQTGMVQQSKQLHHSRVPIGRQPFQGFLRDRFTLR 53 >ref|XP_002516402.1| conserved hypothetical protein [Ricinus communis] gi|223544500|gb|EEF46019.1| conserved hypothetical protein [Ricinus communis] Length = 52 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -2 Query: 224 RWVHESDEVALTTEPCLSVGANWMIGPRTAPSSPHSPFPNM 102 RWV ES EVAL TEPCL VGANWMIGPRT S PHSPFPN+ Sbjct: 12 RWVDESAEVALPTEPCLPVGANWMIGPRTGLSFPHSPFPNI 52 >ref|XP_002515778.1| conserved hypothetical protein [Ricinus communis] gi|223545106|gb|EEF46617.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 157 QFAPTDRHGSVVKATSSLSCTHRTAALSGVP 249 QF PTDRHGSVVKATSSLSCT+RT ALSGVP Sbjct: 57 QFTPTDRHGSVVKATSSLSCTYRTIALSGVP 87 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/41 (73%), Positives = 30/41 (73%) Frame = +2 Query: 149 RSSNSLQQTGMVL*SKQLRHFRVPIGRQPFRGFLRDRFTLR 271 R S G V SKQLRHFRVPIGRQPFRGFLRDR TLR Sbjct: 693 RQSRRATGPGRVRKSKQLRHFRVPIGRQPFRGFLRDRLTLR 733