BLASTX nr result
ID: Jatropha_contig00012349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012349 (574 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY82590.1| putative DRE-binding ERF3 [Jatropha curcas] 60 5e-07 >gb|AAY82590.1| putative DRE-binding ERF3 [Jatropha curcas] Length = 258 Score = 59.7 bits (143), Expect = 5e-07 Identities = 32/52 (61%), Positives = 32/52 (61%) Frame = -1 Query: 460 LCRLDRTVMXXXXXXXXXXXXXXXXXXXXDRSPCNKGLSLDLDLNFPPAEVA 305 LCRLDRTVM DRSPCNKGLSLDLDLNFPPAEVA Sbjct: 207 LCRLDRTVMVSSGVHSDSDSSSVVVDYDHDRSPCNKGLSLDLDLNFPPAEVA 258