BLASTX nr result
ID: Jatropha_contig00012300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012300 (399 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP19885.1| 14.3 kDa oleosin [Jatropha curcas] 61 1e-07 gb|ABW90150.2| oleosin 3 [Jatropha curcas] 61 1e-07 ref|XP_002511014.1| Oleosin 2 [Ricinus communis] gi|38259658|gb|... 61 1e-07 gb|ADB03184.1| oleosin I [Vernicia fordii] 56 4e-06 >gb|AFP19885.1| 14.3 kDa oleosin [Jatropha curcas] Length = 137 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 55 DQARLKLEGKAREMKDRAEQFGQHVTGQQT 144 DQARLKL GKAREMKDRAEQFGQHVTGQQT Sbjct: 108 DQARLKLAGKAREMKDRAEQFGQHVTGQQT 137 >gb|ABW90150.2| oleosin 3 [Jatropha curcas] Length = 137 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 55 DQARLKLEGKAREMKDRAEQFGQHVTGQQT 144 DQARLKL GKAREMKDRAEQFGQHVTGQQT Sbjct: 108 DQARLKLAGKAREMKDRAEQFGQHVTGQQT 137 >ref|XP_002511014.1| Oleosin 2 [Ricinus communis] gi|38259658|gb|AAR15172.1| oleosin [Ricinus communis] gi|223550129|gb|EEF51616.1| Oleosin 2 [Ricinus communis] Length = 138 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 55 DQARLKLEGKAREMKDRAEQFGQHVTGQQT 144 DQARLKL GKAREMKDRAEQFGQHVTGQQT Sbjct: 108 DQARLKLAGKAREMKDRAEQFGQHVTGQQT 137 >gb|ADB03184.1| oleosin I [Vernicia fordii] Length = 137 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 55 DQARLKLEGKAREMKDRAEQFGQHVTGQQT 144 DQAR+KL GKAREMKDRAEQ GQHVTGQ T Sbjct: 108 DQARMKLAGKAREMKDRAEQLGQHVTGQHT 137