BLASTX nr result
ID: Jatropha_contig00012253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012253 (600 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS96447.1| protease inhibitor/seed storage/lipid transfer pr... 60 4e-07 >gb|ACS96447.1| protease inhibitor/seed storage/lipid transfer protein family protein [Jatropha curcas] gi|315937240|gb|ADU56178.1| hypothetical protein [Jatropha curcas] Length = 115 Score = 60.1 bits (144), Expect = 4e-07 Identities = 39/101 (38%), Positives = 55/101 (54%), Gaps = 1/101 (0%) Frame = -3 Query: 445 EGSVKFWASKGFFDC-GNLEGLTGLGKWDLSLKKK*GNLRSRGDAIHQSESFRF*EVAPL 269 E SVKF GF G + G+ G G+ S++ + GNLRS GDAIH ++ E L Sbjct: 2 EASVKFLCLLGFVVIVGIVGGVNGAGECGSSVENELGNLRSCGDAIHDQDA-PVSESCCL 60 Query: 268 RLRKKCQKPTVFLLLYFQNTPKGGGGIPEVALSIPQRSNLS 146 +K Q + + NT K G IPEVA++IP+R N++ Sbjct: 61 EAKKIVQDTSCLCAIVLSNTAKAAGMIPEVAITIPKRCNIA 101