BLASTX nr result
ID: Jatropha_contig00012234
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012234 (208 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67195.1| hypothetical protein [Jatropha curcas] 130 2e-28 >gb|ADJ67195.1| hypothetical protein [Jatropha curcas] Length = 59 Score = 130 bits (326), Expect = 2e-28 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -3 Query: 206 TRKTPQVEKNHDRCQTSIKKNIHYAANCYNHNYKIFFYLTPSKHPKYFILQGIPKDSLI 30 TRKTPQVEKNHDRCQT+IKKNIHYAANCYNHNYKIFFYLTPSKHPKYFILQGIPKDSLI Sbjct: 1 TRKTPQVEKNHDRCQTTIKKNIHYAANCYNHNYKIFFYLTPSKHPKYFILQGIPKDSLI 59