BLASTX nr result
ID: Jatropha_contig00012176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012176 (468 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317296.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-12 ref|XP_002529446.1| conserved hypothetical protein [Ricinus comm... 72 9e-11 ref|XP_003532141.1| PREDICTED: uncharacterized protein LOC100794... 62 1e-07 gb|ESW18507.1| hypothetical protein PHAVU_006G047200g [Phaseolus... 60 4e-07 >ref|XP_002317296.1| predicted protein [Populus trichocarpa] gi|222860361|gb|EEE97908.1| stigma-specific Stig1 family protein [Populus trichocarpa] Length = 159 Score = 75.5 bits (184), Expect = 6e-12 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 2/75 (2%) Frame = -2 Query: 221 RTIFPLSITRAISITLTVKTIKLNPDEKPPFSEQKIDNFST--DQLSIHEEKKLLPSKRL 48 + IF ++IT A SI LT+K++ + +EK P+ E ID +T L +H+EKKL+PSKRL Sbjct: 5 KIIFVIAITTAFSIALTMKSV-VEVEEKQPY-EHSIDTSTTLSQGLIMHDEKKLMPSKRL 62 Query: 47 SRFLAEEKNPRAADH 3 SRFL EEKNPRAADH Sbjct: 63 SRFLTEEKNPRAADH 77 >ref|XP_002529446.1| conserved hypothetical protein [Ricinus communis] gi|223531062|gb|EEF32912.1| conserved hypothetical protein [Ricinus communis] Length = 158 Score = 71.6 bits (174), Expect = 9e-11 Identities = 39/73 (53%), Positives = 49/73 (67%) Frame = -2 Query: 221 RTIFPLSITRAISITLTVKTIKLNPDEKPPFSEQKIDNFSTDQLSIHEEKKLLPSKRLSR 42 + IF ++IT A+SITLTV++I ++KPP FS EE L+PSKRLSR Sbjct: 5 KIIFFIAITMALSITLTVRSIG-EIEDKPPLPVDDSSTFSKGSAVHDEENNLMPSKRLSR 63 Query: 41 FLAEEKNPRAADH 3 FLAE+KNPRAADH Sbjct: 64 FLAEDKNPRAADH 76 >ref|XP_003532141.1| PREDICTED: uncharacterized protein LOC100794169 [Glycine max] Length = 159 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = -2 Query: 221 RTIFPLSITRAISITLTVKTIKLNPDEKPPFSEQKIDNFSTDQLSIHEEKKL---LPSKR 51 + IF ++IT A+SI LT+KTI + KP F +F + + H++K LPSKR Sbjct: 5 KAIFVIAITMALSIALTMKTITHQEEAKPAFVHH---DFPSSSSTPHDQKNNNVHLPSKR 61 Query: 50 LSRFLAEEKNPRAADH 3 +SRFLA+ KNP AADH Sbjct: 62 VSRFLAQVKNPNAADH 77 >gb|ESW18507.1| hypothetical protein PHAVU_006G047200g [Phaseolus vulgaris] Length = 158 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/73 (45%), Positives = 44/73 (60%) Frame = -2 Query: 221 RTIFPLSITRAISITLTVKTIKLNPDEKPPFSEQKIDNFSTDQLSIHEEKKLLPSKRLSR 42 + IF ++ T A+SITLT+KTI + P F + S + + LLPSKR+SR Sbjct: 5 KAIFIVATTMALSITLTMKTIT-QQESNPSFLHHDFPSSSPPPSTTRQNNILLPSKRVSR 63 Query: 41 FLAEEKNPRAADH 3 FLA+ KNP AADH Sbjct: 64 FLAQVKNPNAADH 76