BLASTX nr result
ID: Jatropha_contig00012104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012104 (893 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339137.1| PREDICTED: 40S ribosomal protein S14-2-like ... 64 9e-08 gb|ESR62919.1| hypothetical protein CICLE_v100179502mg, partial ... 64 9e-08 gb|ESR43396.1| hypothetical protein CICLE_v10013022mg [Citrus cl... 64 9e-08 gb|ESQ52240.1| hypothetical protein EUTSA_v10017372mg [Eutrema s... 64 9e-08 gb|ESQ45242.1| hypothetical protein EUTSA_v10010797mg [Eutrema s... 64 9e-08 gb|ESQ40533.1| hypothetical protein EUTSA_v10014925mg [Eutrema s... 64 9e-08 gb|EPS65680.1| hypothetical protein M569_09096 [Genlisea aurea] 64 9e-08 gb|EPS65643.1| hypothetical protein M569_09133, partial [Genlise... 64 9e-08 gb|EOY33397.1| Ribosomal protein S11 family protein [Theobroma c... 64 9e-08 gb|EOY08315.1| Ribosomal protein S11 family protein isoform 1 [T... 64 9e-08 ref|XP_006295174.1| hypothetical protein CARUB_v10024253mg [Caps... 64 9e-08 ref|XP_006292003.1| hypothetical protein CARUB_v10018190mg [Caps... 64 9e-08 ref|XP_004246490.1| PREDICTED: 40S ribosomal protein S14-2-like ... 64 9e-08 gb|ABB87125.1| hypothetical protein [Solanum tuberosum] 64 9e-08 ref|XP_004233114.1| PREDICTED: 40S ribosomal protein S14-2-like ... 64 9e-08 ref|NP_190826.1| 40S ribosomal protein S14-3 [Arabidopsis thalia... 64 9e-08 ref|NP_181158.1| 40S ribosomal protein S14-1 [Arabidopsis thalia... 64 9e-08 pdb|3J0L|K Chain K, Core Of Mammalian 80s Pre-Ribosome In Comple... 64 9e-08 gb|AER57856.1| 40S ribosomal protein S14 [Acytostelium subglobosum] 64 9e-08 gb|ADV38313.1| putative ribosomal protein S14 [Wolffia arrhiza] 64 9e-08 >ref|XP_006339137.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum tuberosum] gi|565348159|ref|XP_006341085.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum tuberosum] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|ESR62919.1| hypothetical protein CICLE_v100179502mg, partial [Citrus clementina] Length = 149 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 108 PGAQSALRALARSGMKIGRIEDVTPIPTDST 138 >gb|ESR43396.1| hypothetical protein CICLE_v10013022mg [Citrus clementina] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|ESQ52240.1| hypothetical protein EUTSA_v10017372mg [Eutrema salsugineum] Length = 140 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 99 PGAQSALRALARSGMKIGRIEDVTPIPTDST 129 >gb|ESQ45242.1| hypothetical protein EUTSA_v10010797mg [Eutrema salsugineum] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|ESQ40533.1| hypothetical protein EUTSA_v10014925mg [Eutrema salsugineum] gi|557108587|gb|ESQ48894.1| hypothetical protein EUTSA_v10021700mg [Eutrema salsugineum] gi|557111957|gb|ESQ52241.1| hypothetical protein EUTSA_v10017372mg [Eutrema salsugineum] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|EPS65680.1| hypothetical protein M569_09096 [Genlisea aurea] Length = 200 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 159 PGAQSALRALARSGMKIGRIEDVTPIPTDST 189 >gb|EPS65643.1| hypothetical protein M569_09133, partial [Genlisea aurea] Length = 149 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 108 PGAQSALRALARSGMKIGRIEDVTPIPTDST 138 >gb|EOY33397.1| Ribosomal protein S11 family protein [Theobroma cacao] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|EOY08315.1| Ribosomal protein S11 family protein isoform 1 [Theobroma cacao] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|XP_006295174.1| hypothetical protein CARUB_v10024253mg [Capsella rubella] gi|565482194|ref|XP_006298737.1| hypothetical protein CARUB_v10014837mg [Capsella rubella] gi|482563882|gb|EOA28072.1| hypothetical protein CARUB_v10024253mg [Capsella rubella] gi|482567446|gb|EOA31635.1| hypothetical protein CARUB_v10014837mg [Capsella rubella] Length = 151 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 110 PGAQSALRALARSGMKIGRIEDVTPIPTDST 140 >ref|XP_006292003.1| hypothetical protein CARUB_v10018190mg [Capsella rubella] gi|482560710|gb|EOA24901.1| hypothetical protein CARUB_v10018190mg [Capsella rubella] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|XP_004246490.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum lycopersicum] gi|460407996|ref|XP_004249434.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum lycopersicum] gi|82623419|gb|ABB87124.1| hypothetical protein [Solanum tuberosum] gi|83284009|gb|ABC01912.1| ribosomal protein S14-like protein [Solanum tuberosum] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|ABB87125.1| hypothetical protein [Solanum tuberosum] Length = 99 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 58 PGAQSALRALARSGMKIGRIEDVTPIPTDST 88 >ref|XP_004233114.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum lycopersicum] gi|565372768|ref|XP_006352960.1| PREDICTED: 40S ribosomal protein S14-2-like [Solanum tuberosum] gi|77745450|gb|ABB02624.1| ribosomal protein S14-like [Solanum tuberosum] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|NP_190826.1| 40S ribosomal protein S14-3 [Arabidopsis thaliana] gi|27735232|sp|P42036.2|RS143_ARATH RecName: Full=40S ribosomal protein S14-3 gi|4886269|emb|CAB43407.1| putative ribosomal protein S14 [Arabidopsis thaliana] gi|16209654|gb|AAL14387.1| AT3g52580/F22O6_40 [Arabidopsis thaliana] gi|21618105|gb|AAM67155.1| putative ribosomal protein S14 [Arabidopsis thaliana] gi|21700837|gb|AAM70542.1| AT3g52580/F22O6_40 [Arabidopsis thaliana] gi|332645444|gb|AEE78965.1| 40S ribosomal protein S14-3 [Arabidopsis thaliana] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >ref|NP_181158.1| 40S ribosomal protein S14-1 [Arabidopsis thaliana] gi|27734451|sp|Q9SIH0.1|RS141_ARATH RecName: Full=40S ribosomal protein S14-1 gi|4678226|gb|AAD26971.1| 40S ribosomal protein S14 [Arabidopsis thaliana] gi|21593698|gb|AAM65665.1| 40S ribosomal protein S14 [Arabidopsis thaliana] gi|330254117|gb|AEC09211.1| 40S ribosomal protein S14-1 [Arabidopsis thaliana] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >pdb|3J0L|K Chain K, Core Of Mammalian 80s Pre-Ribosome In Complex With Trnas Fitted To A 9.8a Cryo-Em Map: Classic Pre State 1 gi|357380473|pdb|3J0O|K Chain K, Core Of Mammalian 80s Pre-Ribosome In Complex With Trnas Fitted To A 9a Cryo-Em Map: Classic Pre State 2 Length = 140 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 99 PGAQSALRALARSGMKIGRIEDVTPIPTDST 129 >gb|AER57856.1| 40S ribosomal protein S14 [Acytostelium subglobosum] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139 >gb|ADV38313.1| putative ribosomal protein S14 [Wolffia arrhiza] Length = 150 Score = 63.5 bits (153), Expect = 9e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 495 PGAQSALRALARSGMKIGRIEDVTPIPTDST 587 PGAQSALRALARSGMKIGRIEDVTPIPTDST Sbjct: 109 PGAQSALRALARSGMKIGRIEDVTPIPTDST 139