BLASTX nr result
ID: Jatropha_contig00012075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012075 (762 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67204.1| hypothetical protein [Jatropha curcas] 128 2e-27 >gb|ADJ67204.1| hypothetical protein [Jatropha curcas] Length = 84 Score = 128 bits (321), Expect = 2e-27 Identities = 67/80 (83%), Positives = 71/80 (88%), Gaps = 1/80 (1%) Frame = -2 Query: 392 MATPKAGILKVEDGATLKVETLKVGMGNT-QEETLEVEDMVIHRVETLKVEAGGTRDNTY 216 MATPKA ILKVEDGATLKVETLKV G +EETL+VEDMVI RVETLKV GGTRDNT+ Sbjct: 1 MATPKAEILKVEDGATLKVETLKVEDGEILKEETLKVEDMVIPRVETLKVGGGGTRDNTF 60 Query: 215 EGNTQDDGGYGNTRERKKYA 156 EGNTQDDGGYGNTRER+KYA Sbjct: 61 EGNTQDDGGYGNTREREKYA 80