BLASTX nr result
ID: Jatropha_contig00012023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012023 (577 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS96447.1| protease inhibitor/seed storage/lipid transfer pr... 59 8e-07 >gb|ACS96447.1| protease inhibitor/seed storage/lipid transfer protein family protein [Jatropha curcas] gi|315937240|gb|ADU56178.1| hypothetical protein [Jatropha curcas] Length = 115 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -1 Query: 331 KIVKNPSFLFAFVFQTPVRAAGMIPKVAISIPKRCNKDDLPVGPPCGD 188 KIV++ S L A V +AAGMIP+VAI+IPKRCN D PVG CGD Sbjct: 64 KIVQDTSCLCAIVLSNTAKAAGMIPEVAITIPKRCNIADRPVGHQCGD 111