BLASTX nr result
ID: Jatropha_contig00011979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011979 (561 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67204.1| hypothetical protein [Jatropha curcas] 120 2e-25 gb|ADJ67211.1| hypothetical protein [Jatropha curcas] 69 1e-09 gb|ADU56193.1| hypothetical protein [Jatropha curcas] 64 3e-08 >gb|ADJ67204.1| hypothetical protein [Jatropha curcas] Length = 84 Score = 120 bits (302), Expect = 2e-25 Identities = 63/82 (76%), Positives = 67/82 (81%) Frame = +2 Query: 221 PREETLKVEDGVTPREETLKVEGMATPKAEILKEETLKVEDMVIHRVETLKVEAGGTRDN 400 P+ E LKVEDG T + ETLKVE EILKEETLKVEDMVI RVETLKV GGTRDN Sbjct: 4 PKAEILKVEDGATLKVETLKVED-----GEILKEETLKVEDMVIPRVETLKVGGGGTRDN 58 Query: 401 TYEGNTQDDGGYGNTRERKKYA 466 T+EGNTQDDGGYGNTRER+KYA Sbjct: 59 TFEGNTQDDGGYGNTREREKYA 80 >gb|ADJ67211.1| hypothetical protein [Jatropha curcas] Length = 98 Score = 68.6 bits (166), Expect = 1e-09 Identities = 44/80 (55%), Positives = 51/80 (63%) Frame = +2 Query: 140 K*SSEVQVFLREKCQLKEETLKEDGVIPREETLKVEDGVTPREETLKVEGMATPKAEILK 319 K SS+VQV L ++C+LKEETLKE+GVI RE LK E V PR L+VE PK Sbjct: 7 KHSSKVQVSLVKQCRLKEETLKEEGVILREGILKAEVVVIPRVVILRVEDGGIPKV---- 62 Query: 320 EETLKVEDMVIHRVETLKVE 379 ETLK E + I R ETLK E Sbjct: 63 -ETLKAEVVAILREETLKAE 81 >gb|ADU56193.1| hypothetical protein [Jatropha curcas] Length = 102 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/65 (56%), Positives = 38/65 (58%), Gaps = 8/65 (12%) Frame = -3 Query: 379 LHLECFHPVYYHILHLECFL--------LEYFRLGCCHTLHLECFLPGCYPILHLECFLP 224 LHLECF + ILHLE FL LEYFRLG H L LECFLP LH FLP Sbjct: 30 LHLECFLLGCFPILHLEYFLPECYPILRLEYFRLGYYHILRLECFLPEYCHHLHPAYFLP 89 Query: 223 GYYPI 209 G YPI Sbjct: 90 GCYPI 94 Score = 62.0 bits (149), Expect = 9e-08 Identities = 33/51 (64%), Positives = 33/51 (64%) Frame = -3 Query: 379 LHLECFHPVYYHILHLECFLLEYFRLGCCHTLHLECFLPGCYPILHLECFL 227 L LE F YYHIL LECFL EY CH LH FLPGCYPIL ECFL Sbjct: 56 LRLEYFRLGYYHILRLECFLPEY-----CHHLHPAYFLPGCYPIL-FECFL 100