BLASTX nr result
ID: Jatropha_contig00011970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011970 (366 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67204.1| hypothetical protein [Jatropha curcas] 125 4e-27 >gb|ADJ67204.1| hypothetical protein [Jatropha curcas] Length = 84 Score = 125 bits (315), Expect = 4e-27 Identities = 62/67 (92%), Positives = 64/67 (95%) Frame = +1 Query: 4 GATLKVETLKVEDGEILKEETLKVEDMVIHRVETLKVEAGGTRDNTYEGNTQDDGGYGNT 183 GATLKVETLKVEDGEILKEETLKVEDMVI RVETLKV GGTRDNT+EGNTQDDGGYGNT Sbjct: 14 GATLKVETLKVEDGEILKEETLKVEDMVIPRVETLKVGGGGTRDNTFEGNTQDDGGYGNT 73 Query: 184 RERKKYA 204 RER+KYA Sbjct: 74 REREKYA 80