BLASTX nr result
ID: Jatropha_contig00011969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011969 (428 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACS96447.1| protease inhibitor/seed storage/lipid transfer pr... 62 6e-08 >gb|ACS96447.1| protease inhibitor/seed storage/lipid transfer protein family protein [Jatropha curcas] gi|315937240|gb|ADU56178.1| hypothetical protein [Jatropha curcas] Length = 115 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = -1 Query: 398 LKEWGDAIPDQDAPVSESCCLEDKKIVQDPSGLCAIVFQTPLRLLG 261 L+ GDAI DQDAPVSESCCLE KKIVQD S LCAIV + G Sbjct: 40 LRSCGDAIHDQDAPVSESCCLEAKKIVQDTSCLCAIVLSNTAKAAG 85 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 3/49 (6%) Frame = -3 Query: 309 QRSLCYC---LSNTAKAAGMIPEVAIPFPRDATLLTVTVDHQCGDYTLP 172 Q + C C LSNTAKAAGMIPEVAI P+ + V HQCGDYTLP Sbjct: 67 QDTSCLCAIVLSNTAKAAGMIPEVAITIPKRCNIADRPVGHQCGDYTLP 115