BLASTX nr result
ID: Jatropha_contig00011683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011683 (782 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV50434.1| annexin-like protein [Jatropha curcas] 57 9e-06 >gb|ACV50434.1| annexin-like protein [Jatropha curcas] Length = 314 Score = 56.6 bits (135), Expect = 9e-06 Identities = 32/69 (46%), Positives = 43/69 (62%) Frame = -3 Query: 501 SLLGEKSGQRICKILGIAIRNQERAS*ILRERYCANALKGIGTEEEALTRRNVPKAEKDL 322 +LLGEK+ ++L IAIR E+ NA+K IGT+E+ALTR V +AEKDL Sbjct: 217 ALLGEKADNEFVRLLSIAIRTMNEPLKYY-EKVLRNAIKRIGTDEDALTRVIVTRAEKDL 275 Query: 321 LHIRNSSPR 295 LHI+ P+ Sbjct: 276 LHIKELYPK 284