BLASTX nr result
ID: Jatropha_contig00011639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011639 (617 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67207.1| early nodulin 20 precursor [Jatropha curcas] 48 9e-09 >gb|ADJ67207.1| early nodulin 20 precursor [Jatropha curcas] Length = 140 Score = 48.1 bits (113), Expect(2) = 9e-09 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -2 Query: 406 QPPPSDNFAAGRVDRAILAGTV 341 QPPPSDNFAAGRVDRAILAGTV Sbjct: 108 QPPPSDNFAAGRVDRAILAGTV 129 Score = 37.7 bits (86), Expect(2) = 9e-09 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = -3 Query: 612 PQTSPNPVPQISTNTVPSPFPSSPALKPSPE 520 P+ +P P P+ + PSP PSSPA KPSP+ Sbjct: 40 PKPAPTPSPKSAPTPSPSPSPSSPAPKPSPK 70