BLASTX nr result
ID: Jatropha_contig00011596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011596 (706 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67204.1| hypothetical protein [Jatropha curcas] 109 9e-22 >gb|ADJ67204.1| hypothetical protein [Jatropha curcas] Length = 84 Score = 109 bits (272), Expect = 9e-22 Identities = 58/71 (81%), Positives = 61/71 (85%), Gaps = 1/71 (1%) Frame = -1 Query: 421 QVEDGATLKVNTQGGGWG-ILKEETLKVEDMVIHRVETLKVEAGGTRDNTYEGNTQDDGG 245 +VEDGATLKV T G ILKEETLKVEDMVI RVETLKV GGTRDNT+EGNTQDDGG Sbjct: 10 KVEDGATLKVETLKVEDGEILKEETLKVEDMVIPRVETLKVGGGGTRDNTFEGNTQDDGG 69 Query: 244 YGNTRERKKYA 212 YGNTRER+KYA Sbjct: 70 YGNTREREKYA 80