BLASTX nr result
ID: Jatropha_contig00011594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011594 (692 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67204.1| hypothetical protein [Jatropha curcas] 137 2e-30 >gb|ADJ67204.1| hypothetical protein [Jatropha curcas] Length = 84 Score = 137 bits (346), Expect = 2e-30 Identities = 68/77 (88%), Positives = 72/77 (93%) Frame = -3 Query: 423 PRREILKVEDGATLKVKPLKVEDGEILKEETLKVEDMVIHRVETLKVEAGGTRDNTYEGN 244 P+ EILKVEDGATLKV+ LKVEDGEILKEETLKVEDMVI RVETLKV GGTRDNT+EGN Sbjct: 4 PKAEILKVEDGATLKVETLKVEDGEILKEETLKVEDMVIPRVETLKVGGGGTRDNTFEGN 63 Query: 243 TQDDGGYGNTRERKKYA 193 TQDDGGYGNTRER+KYA Sbjct: 64 TQDDGGYGNTREREKYA 80