BLASTX nr result
ID: Jatropha_contig00011588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011588 (595 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67188.1| hypothetical protein [Jatropha curcas] 142 6e-32 >gb|ADJ67188.1| hypothetical protein [Jatropha curcas] Length = 81 Score = 142 bits (358), Expect = 6e-32 Identities = 71/81 (87%), Positives = 71/81 (87%) Frame = +1 Query: 1 RTRKGYVLPLERKRGSNYLCEMNTNRKYKIKKEKLDMRDFKGXXXXXXXXXXHPTKDSIS 180 RTRKGYVLPLERKRGSNYLCEMNTNRKYKIKKEKLDMRDFKG HPTKDSIS Sbjct: 1 RTRKGYVLPLERKRGSNYLCEMNTNRKYKIKKEKLDMRDFKGNKIILNILKIHPTKDSIS 60 Query: 181 NHNFLLNLTLKAFSSLLKASI 243 NHNFLLNLTLKAFSSLLKASI Sbjct: 61 NHNFLLNLTLKAFSSLLKASI 81