BLASTX nr result
ID: Jatropha_contig00011330
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011330 (614 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67211.1| hypothetical protein [Jatropha curcas] 91 2e-16 gb|ADU56193.1| hypothetical protein [Jatropha curcas] 66 6e-09 >gb|ADJ67211.1| hypothetical protein [Jatropha curcas] Length = 98 Score = 91.3 bits (225), Expect = 2e-16 Identities = 52/72 (72%), Positives = 59/72 (81%) Frame = +2 Query: 11 NISQKNSSELPVSLLKHCRLKEEILGEDGVAILWEETLGVEMMVIPTVVILRVEDGAIPK 190 NISQK+SS++ VSL+K CRLKEE L E+GV IL E L E++VIP VVILRVEDG IPK Sbjct: 3 NISQKHSSKVQVSLVKQCRLKEETLKEEGV-ILREGILKAEVVVIPRVVILRVEDGGIPK 61 Query: 191 EETLKAEVVAIL 226 ETLKAEVVAIL Sbjct: 62 VETLKAEVVAIL 73 >gb|ADU56193.1| hypothetical protein [Jatropha curcas] Length = 102 Score = 66.2 bits (160), Expect = 6e-09 Identities = 37/76 (48%), Positives = 42/76 (55%), Gaps = 13/76 (17%) Frame = -2 Query: 262 IATTSALSVPSIEYCHHLRLECFLLGYCPILHPEYY-------------HRGYYHHLHPE 122 I + S +S+ S C HL ECFLLG PILH EY+ GYYH L E Sbjct: 15 ILSVSFISIISNTACLHL--ECFLLGCFPILHLEYFLPECYPILRLEYFRLGYYHILRLE 72 Query: 121 CFLPEYCHPILPEYFL 74 CFLPEYCH + P YFL Sbjct: 73 CFLPEYCHHLHPAYFL 88