BLASTX nr result
ID: Jatropha_contig00011320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011320 (327 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532311.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 gb|ESR66370.1| hypothetical protein CICLE_v10009016mg [Citrus cl... 58 1e-06 gb|ERP49939.1| hypothetical protein POPTR_0018s124802g, partial ... 56 4e-06 ref|XP_002262947.2| PREDICTED: protein OS-9-like [Vitis vinifera] 56 5e-06 emb|CBI25568.3| unnamed protein product [Vitis vinifera] 56 5e-06 >ref|XP_002532311.1| conserved hypothetical protein [Ricinus communis] gi|223527980|gb|EEF30063.1| conserved hypothetical protein [Ricinus communis] Length = 332 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +2 Query: 23 EERPVWHTINCDVLSKDSKGTKAEKLKTEEKQIIMVTGIEY 145 EERPVWHTI+C+ L KD + TKAE KT +KQIIMVT EY Sbjct: 284 EERPVWHTIDCNALPKDYEETKAENDKTVDKQIIMVTDAEY 324 >gb|ESR66370.1| hypothetical protein CICLE_v10009016mg [Citrus clementina] Length = 304 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +2 Query: 23 EERPVWHTINCDVLSKDSKGTKAEKLKTEEKQIIMVTG 136 EERPVWHTI+C+VL D K TK E+ K E KQI+MVTG Sbjct: 255 EERPVWHTIDCNVLPNDYKATKVEEDKVESKQILMVTG 292 >gb|ERP49939.1| hypothetical protein POPTR_0018s124802g, partial [Populus trichocarpa] Length = 128 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/40 (57%), Positives = 33/40 (82%) Frame = +2 Query: 23 EERPVWHTINCDVLSKDSKGTKAEKLKTEEKQIIMVTGIE 142 EERPVWHTINC++L KD K K ++++TE++QI MV+ +E Sbjct: 81 EERPVWHTINCNLLPKDYKEAKPDEVETEDEQIFMVSDVE 120 >ref|XP_002262947.2| PREDICTED: protein OS-9-like [Vitis vinifera] Length = 299 Score = 55.8 bits (133), Expect = 5e-06 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +2 Query: 23 EERPVWHTINCDVLSKDSKGTKAEKLKTEEKQIIMVTGIEY 145 EERPVWH INC+ L KD K TKAE+ + KQI M T +EY Sbjct: 251 EERPVWHIINCNALPKDYKETKAEEAPFKNKQITMATDVEY 291 >emb|CBI25568.3| unnamed protein product [Vitis vinifera] Length = 296 Score = 55.8 bits (133), Expect = 5e-06 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +2 Query: 23 EERPVWHTINCDVLSKDSKGTKAEKLKTEEKQIIMVTGIEY 145 EERPVWH INC+ L KD K TKAE+ + KQI M T +EY Sbjct: 248 EERPVWHIINCNALPKDYKETKAEEAPFKNKQITMATDVEY 288