BLASTX nr result
ID: Jatropha_contig00011291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011291 (531 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU56193.1| hypothetical protein [Jatropha curcas] 70 3e-10 gb|ADJ67204.1| hypothetical protein [Jatropha curcas] 58 1e-06 >gb|ADU56193.1| hypothetical protein [Jatropha curcas] Length = 102 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/42 (80%), Positives = 34/42 (80%) Frame = +2 Query: 185 MLIFSFPSXXXXXXXLRVSFISIISNTACLHLECFLLGCFPI 310 MLIFSFPS L VSFISIISNTACLHLECFLLGCFPI Sbjct: 1 MLIFSFPSITITTIILSVSFISIISNTACLHLECFLLGCFPI 42 >gb|ADJ67204.1| hypothetical protein [Jatropha curcas] Length = 84 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 298 PKEETLKVEAGGVRDNTYEGNPQNDGGYGNTRE 200 P+ ETLKV GG RDNT+EGN Q+DGGYGNTRE Sbjct: 43 PRVETLKVGGGGTRDNTFEGNTQDDGGYGNTRE 75