BLASTX nr result
ID: Jatropha_contig00011288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011288 (609 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314027.1| predicted protein [Populus trichocarpa] gi|2... 64 3e-13 ref|XP_002298442.1| predicted protein [Populus trichocarpa] gi|1... 62 8e-13 gb|ACR56825.1| At3g12630-like protein [Solanum quitoense] gi|238... 60 1e-12 ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing st... 61 2e-12 ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-co... 61 2e-12 ref|XP_002513177.1| zinc finger protein, putative [Ricinus commu... 62 2e-12 gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] 59 3e-12 gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus... 61 4e-12 ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-co... 61 4e-12 ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 5e-12 ref|XP_004229613.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 5e-12 gb|ACR56827.1| At3g12630-like protein [Solanum hirtum] 58 5e-12 gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] 60 6e-12 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] 60 6e-12 gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus cl... 59 8e-12 ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-co... 58 9e-12 gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-... 60 1e-11 ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-co... 59 1e-11 ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-co... 60 1e-11 ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Caps... 60 1e-11 >ref|XP_002314027.1| predicted protein [Populus trichocarpa] gi|222850435|gb|EEE87982.1| zinc finger family protein [Populus trichocarpa] Length = 179 Score = 63.9 bits (154), Expect(3) = 3e-13 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 430 WEHRYSDRHDCSYDYKAAGREAITRENP 347 WEHRYSDRHDCSYDYK AGREAI RENP Sbjct: 142 WEHRYSDRHDCSYDYKTAGREAIARENP 169 Score = 34.3 bits (77), Expect(3) = 3e-13 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 R+G GFRCRCGELFC Sbjct: 126 RVGLTGFRCRCGELFC 141 Score = 22.3 bits (46), Expect(3) = 3e-13 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRR+VGLT Sbjct: 122 GCRRRVGLT 130 >ref|XP_002298442.1| predicted protein [Populus trichocarpa] gi|118486081|gb|ABK94884.1| unknown [Populus trichocarpa] gi|222845700|gb|EEE83247.1| zinc finger family protein [Populus trichocarpa] Length = 181 Score = 62.4 bits (150), Expect(3) = 8e-13 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 430 WEHRYSDRHDCSYDYKAAGREAITRENP 347 WEHRYSDRHDCSYDYK GREAI RENP Sbjct: 144 WEHRYSDRHDCSYDYKTVGREAIARENP 171 Score = 34.3 bits (77), Expect(3) = 8e-13 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 R+G GFRCRCGELFC Sbjct: 128 RVGLTGFRCRCGELFC 143 Score = 22.3 bits (46), Expect(3) = 8e-13 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRR+VGLT Sbjct: 124 GCRRRVGLT 132 >gb|ACR56825.1| At3g12630-like protein [Solanum quitoense] gi|238816903|gb|ACR56826.1| At3g12630-like protein [Solanum quitoense] Length = 150 Score = 59.7 bits (143), Expect(3) = 1e-12 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK AGREAI RENP Sbjct: 120 EHRYSDRHDCSYDYKTAGREAIARENP 146 Score = 33.1 bits (74), Expect(3) = 1e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 103 KVGLTGFRCRCGELFC 118 Score = 25.8 bits (55), Expect(3) = 1e-12 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 579 KRLRDRLTLEMGDLEARPLSSGINAEYAGGCRRKVGLT 466 K++ DR E L+ + GCRRKVGLT Sbjct: 70 KKVGDRTVKEEDQLKESLPPAKREVSRCSGCRRKVGLT 107 >ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] gi|300510880|gb|ADK25058.1| AN1-like transcription factor [Glycine max] Length = 164 Score = 61.2 bits (147), Expect(3) = 2e-12 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYKAAGREAI RENP Sbjct: 128 EHRYSDRHDCSYDYKAAGREAIARENP 154 Score = 33.1 bits (74), Expect(3) = 2e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 111 KVGLTGFRCRCGELFC 126 Score = 23.5 bits (49), Expect(3) = 2e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 107 GCRRKVGLT 115 >ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] Length = 161 Score = 61.2 bits (147), Expect(3) = 2e-12 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYKAAGREAI RENP Sbjct: 125 EHRYSDRHDCSYDYKAAGREAIARENP 151 Score = 33.1 bits (74), Expect(3) = 2e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 108 KVGLTGFRCRCGELFC 123 Score = 23.5 bits (49), Expect(3) = 2e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 104 GCRRKVGLT 112 >ref|XP_002513177.1| zinc finger protein, putative [Ricinus communis] gi|223547675|gb|EEF49168.1| zinc finger protein, putative [Ricinus communis] Length = 140 Score = 62.4 bits (150), Expect(3) = 2e-12 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 430 WEHRYSDRHDCSYDYKAAGREAITRENP 347 WEHRYSDRHDCSYDYK GREAI RENP Sbjct: 103 WEHRYSDRHDCSYDYKTVGREAIARENP 130 Score = 32.0 bits (71), Expect(3) = 2e-12 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCG+LFC Sbjct: 87 KVGLTGFRCRCGDLFC 102 Score = 23.5 bits (49), Expect(3) = 2e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 83 GCRRKVGLT 91 >gb|ACR56824.1| At3g12630-like protein [Solanum hirtum] Length = 147 Score = 58.5 bits (140), Expect(3) = 3e-12 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDC+YDYK AGREAI RENP Sbjct: 117 EHRYSDRHDCNYDYKTAGREAIARENP 143 Score = 33.1 bits (74), Expect(3) = 3e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 100 KVGLTGFRCRCGELFC 115 Score = 25.4 bits (54), Expect(3) = 3e-12 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 579 KRLRDRLTLEMGDLEARPLSSGINAEYAGGCRRKVGLT 466 K++ DR E L+ + GCRRKVGLT Sbjct: 67 KKVGDRKVKEEDQLKESLPPAKREVNRCSGCRRKVGLT 104 >gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris] Length = 301 Score = 61.2 bits (147), Expect(3) = 4e-12 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYKAAGREAI RENP Sbjct: 265 EHRYSDRHDCSYDYKAAGREAIARENP 291 Score = 32.0 bits (71), Expect(3) = 4e-12 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCG+LFC Sbjct: 248 KVGLTGFRCRCGDLFC 263 Score = 23.5 bits (49), Expect(3) = 4e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 244 GCRRKVGLT 252 >ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Glycine max] Length = 137 Score = 61.2 bits (147), Expect(3) = 4e-12 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYKAAGREAI RENP Sbjct: 101 EHRYSDRHDCSYDYKAAGREAIARENP 127 Score = 33.1 bits (74), Expect(3) = 4e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 R+G GFRCRCG+LFC Sbjct: 84 RVGLTGFRCRCGDLFC 99 Score = 22.3 bits (46), Expect(3) = 4e-12 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRR+VGLT Sbjct: 80 GCRRRVGLT 88 >ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform 1 [Solanum lycopersicum] gi|88866527|gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum] Length = 188 Score = 59.7 bits (143), Expect(3) = 5e-12 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK AGREAI RENP Sbjct: 152 EHRYSDRHDCSYDYKTAGREAIARENP 178 Score = 33.1 bits (74), Expect(3) = 5e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 135 KVGLTGFRCRCGELFC 150 Score = 23.5 bits (49), Expect(3) = 5e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 131 GCRRKVGLT 139 >ref|XP_004229613.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform 2 [Solanum lycopersicum] Length = 159 Score = 59.7 bits (143), Expect(3) = 5e-12 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK AGREAI RENP Sbjct: 123 EHRYSDRHDCSYDYKTAGREAIARENP 149 Score = 33.1 bits (74), Expect(3) = 5e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 106 KVGLTGFRCRCGELFC 121 Score = 23.5 bits (49), Expect(3) = 5e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 102 GCRRKVGLT 110 >gb|ACR56827.1| At3g12630-like protein [Solanum hirtum] Length = 151 Score = 57.8 bits (138), Expect(3) = 5e-12 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDC YDYK AGREAI RENP Sbjct: 121 EHRYSDRHDCXYDYKTAGREAIARENP 147 Score = 33.1 bits (74), Expect(3) = 5e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 104 KVGLTGFRCRCGELFC 119 Score = 25.4 bits (54), Expect(3) = 5e-12 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 579 KRLRDRLTLEMGDLEARPLSSGINAEYAGGCRRKVGLT 466 K++ DR E L+ + GCRRKVGLT Sbjct: 71 KKVGDRTXKEEDQLKESLPPAKREVNRCSGCRRKVGLT 108 >gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii] Length = 87 Score = 59.7 bits (143), Expect(3) = 6e-12 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK AGREAI RENP Sbjct: 51 EHRYSDRHDCSYDYKTAGREAIARENP 77 Score = 33.1 bits (74), Expect(3) = 6e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 34 KVGLTGFRCRCGELFC 49 Score = 23.5 bits (49), Expect(3) = 6e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 30 GCRRKVGLT 38 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] Length = 88 Score = 59.7 bits (143), Expect(3) = 6e-12 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK AGREAI RENP Sbjct: 52 EHRYSDRHDCSYDYKTAGREAIARENP 78 Score = 33.1 bits (74), Expect(3) = 6e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 35 KVGLTGFRCRCGELFC 50 Score = 23.5 bits (49), Expect(3) = 6e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 31 GCRRKVGLT 39 >gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus clementina] Length = 179 Score = 58.9 bits (141), Expect(3) = 8e-12 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK+AGR+AI RENP Sbjct: 143 EHRYSDRHDCSYDYKSAGRDAIARENP 169 Score = 33.1 bits (74), Expect(3) = 8e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 126 KVGLTGFRCRCGELFC 141 Score = 23.5 bits (49), Expect(3) = 8e-12 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 122 GCRRKVGLT 130 >ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cicer arietinum] Length = 160 Score = 58.2 bits (139), Expect(3) = 9e-12 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK GREAI RENP Sbjct: 124 EHRYSDRHDCSYDYKTVGREAIARENP 150 Score = 33.1 bits (74), Expect(3) = 9e-12 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 R+G GFRCRCG+LFC Sbjct: 107 RVGLTGFRCRCGDLFC 122 Score = 24.3 bits (51), Expect(3) = 9e-12 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = -1 Query: 543 DLEARPLSSGINAEYA----GGCRRKVGLT 466 D + +P ++ A+ A GCRR+VGLT Sbjct: 82 DTQVQPQTTSSEAKRAVNRCSGCRRRVGLT 111 >gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 5, putative [Theobroma cacao] Length = 192 Score = 59.7 bits (143), Expect(3) = 1e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK AGREAI RENP Sbjct: 156 EHRYSDRHDCSYDYKTAGREAIARENP 182 Score = 34.3 bits (77), Expect(3) = 1e-11 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 R+G GFRCRCGELFC Sbjct: 139 RVGLTGFRCRCGELFC 154 Score = 21.2 bits (43), Expect(3) = 1e-11 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCR++VGLT Sbjct: 135 GCRKRVGLT 143 >ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Solanum tuberosum] Length = 187 Score = 58.5 bits (140), Expect(3) = 1e-11 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDC+YDYK AGREAI RENP Sbjct: 151 EHRYSDRHDCNYDYKTAGREAIARENP 177 Score = 33.1 bits (74), Expect(3) = 1e-11 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 134 KVGLTGFRCRCGELFC 149 Score = 23.5 bits (49), Expect(3) = 1e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 130 GCRRKVGLT 138 >ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cicer arietinum] Length = 165 Score = 59.7 bits (143), Expect(3) = 1e-11 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCS+DYKAAGREAI RENP Sbjct: 129 EHRYSDRHDCSFDYKAAGREAIARENP 155 Score = 32.0 bits (71), Expect(3) = 1e-11 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCG+LFC Sbjct: 112 KVGLTGFRCRCGDLFC 127 Score = 23.5 bits (49), Expect(3) = 1e-11 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCRRKVGLT Sbjct: 108 GCRRKVGLT 116 >ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Capsella rubella] gi|482567416|gb|EOA31605.1| hypothetical protein CARUB_v10014801mg [Capsella rubella] Length = 163 Score = 59.7 bits (143), Expect(3) = 1e-11 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 427 EHRYSDRHDCSYDYKAAGREAITRENP 347 EHRYSDRHDCSYDYK AGREAI RENP Sbjct: 127 EHRYSDRHDCSYDYKTAGREAIARENP 153 Score = 33.1 bits (74), Expect(3) = 1e-11 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 479 RLG*PGFRCRCGELFC 432 ++G GFRCRCGELFC Sbjct: 110 KVGLTGFRCRCGELFC 125 Score = 22.3 bits (46), Expect(3) = 1e-11 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 492 GCRRKVGLT 466 GCR+KVGLT Sbjct: 106 GCRKKVGLT 114