BLASTX nr result
ID: Jatropha_contig00011276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011276 (600 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517365.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002517365.1| conserved hypothetical protein [Ricinus communis] gi|223543376|gb|EEF44907.1| conserved hypothetical protein [Ricinus communis] Length = 168 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 517 YALNLTRLLGKMS-FDEDLMGREFSSRYSLPPSCKSSLDFDND 392 YALN G+ FDEDL+GR FSSRYSLPPSCK+SLDFD + Sbjct: 120 YALNFDEGPGQNGHFDEDLVGRGFSSRYSLPPSCKTSLDFDRE 162