BLASTX nr result
ID: Jatropha_contig00011244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011244 (237 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516402.1| conserved hypothetical protein [Ricinus comm... 66 4e-09 >ref|XP_002516402.1| conserved hypothetical protein [Ricinus communis] gi|223544500|gb|EEF46019.1| conserved hypothetical protein [Ricinus communis] Length = 52 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +3 Query: 24 ESDEVALTTEPCLSVGANWMIGPRTAPSSPHSPFPNM 134 ES EVAL TEPCL VGANWMIGPRT S PHSPFPN+ Sbjct: 16 ESAEVALPTEPCLPVGANWMIGPRTGLSFPHSPFPNI 52