BLASTX nr result
ID: Jatropha_contig00011241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011241 (441 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGL34960.1| ethylene-responsive transcription factor 1 [Hevea... 58 1e-06 gb|AEK82608.1| ethylene-responsive element binding protein 1 [He... 58 1e-06 >gb|AGL34960.1| ethylene-responsive transcription factor 1 [Hevea brasiliensis] Length = 243 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 15 GVQXXXXXXXVIDLNQLDINPPRRNLDFDLNLPPKPEI 128 GVQ V+DLNQ +INPPR++LDFDLNLPPKPEI Sbjct: 205 GVQSDSDSSSVVDLNQHEINPPRKSLDFDLNLPPKPEI 242 >gb|AEK82608.1| ethylene-responsive element binding protein 1 [Hevea brasiliensis] Length = 243 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 15 GVQXXXXXXXVIDLNQLDINPPRRNLDFDLNLPPKPEI 128 GVQ V+DLNQ +INPPR++LDFDLNLPPKPEI Sbjct: 205 GVQSDSDSSSVVDLNQHEINPPRKSLDFDLNLPPKPEI 242