BLASTX nr result
ID: Jatropha_contig00011190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011190 (625 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511946.1| conserved hypothetical protein [Ricinus comm... 77 4e-12 >ref|XP_002511946.1| conserved hypothetical protein [Ricinus communis] gi|223549126|gb|EEF50615.1| conserved hypothetical protein [Ricinus communis] Length = 265 Score = 77.0 bits (188), Expect = 4e-12 Identities = 45/96 (46%), Positives = 52/96 (54%), Gaps = 4/96 (4%) Frame = -1 Query: 535 DLKKSTSTVEDGHGENFCXXXXXXXXXXXXXXXXXXXXXXA--LKDWNGVRDSV--HLRS 368 DLKKS S E G+ EN C + LKDWN VR+ HLRS Sbjct: 170 DLKKSVSMEEVGNAENSCGESGDLSSDGADSTTSSSSSAASTALKDWNSVRNLAGNHLRS 229 Query: 367 SSDGGGLFCGLLLHRRLPICFSAQNLQVYGESEKEN 260 SSDGGG FCGL+ RRL +C SAQNL + SE+EN Sbjct: 230 SSDGGGFFCGLMKQRRLTMCLSAQNLSSFSGSEREN 265