BLASTX nr result
ID: Jatropha_contig00011165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011165 (581 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66138.1| hypothetical protein M569_08641, partial [Genlise... 51 7e-11 ref|XP_004166624.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 54 1e-10 gb|ESW15539.1| hypothetical protein PHAVU_007G080600g [Phaseolus... 49 2e-10 ref|XP_006300559.1| hypothetical protein CARUB_v10021037mg [Caps... 48 2e-10 ref|XP_006300560.1| hypothetical protein CARUB_v10021037mg [Caps... 48 2e-10 ref|XP_002889100.1| hypothetical protein ARALYDRAFT_476836 [Arab... 48 9e-10 ref|NP_177802.2| thioredoxin Y1 [Arabidopsis thaliana] gi|753243... 48 1e-09 gb|AAF04439.1|AC010718_8 thioredoxin-like protein; 49720-48645 [... 48 1e-09 gb|ESQ27443.1| hypothetical protein EUTSA_v10019218mg [Eutrema s... 48 2e-09 gb|ESQ33275.1| hypothetical protein EUTSA_v10005020mg [Eutrema s... 47 3e-09 ref|XP_006305716.1| hypothetical protein CARUB_v10010465mg [Caps... 47 6e-09 ref|XP_002524295.1| thioredoxin m(mitochondrial)-type, putative ... 66 7e-09 gb|AAD39273.1|AC007203_5 Hypothetical protein [Arabidopsis thali... 45 9e-09 ref|XP_002893945.1| hypothetical protein ARALYDRAFT_891327 [Arab... 45 9e-09 ref|NP_175021.2| thioredoxin Y2 [Arabidopsis thaliana] gi|753297... 45 9e-09 ref|XP_002302170.1| thioredoxin y [Populus trichocarpa] gi|22284... 65 2e-08 ref|XP_002456987.1| hypothetical protein SORBIDRAFT_03g046830 [S... 47 3e-08 ref|NP_001168881.1| putative thioredoxin superfamily protein [Ze... 47 8e-08 ref|XP_004237802.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 44 1e-07 ref|XP_006359806.1| PREDICTED: thioredoxin Y1, chloroplastic-lik... 44 1e-07 >gb|EPS66138.1| hypothetical protein M569_08641, partial [Genlisea aurea] Length = 171 Score = 50.8 bits (120), Expect(2) = 7e-11 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKPL 242 +YP +A+KYRIEALPTFI+FKDGKPL Sbjct: 126 KYPEVANKYRIEALPTFILFKDGKPL 151 Score = 42.0 bits (97), Expect(2) = 7e-11 Identities = 27/61 (44%), Positives = 36/61 (59%) Frame = -1 Query: 494 QPFPPSEELAGKCRTNPGIRLTFMQPGAGSLFKLWVPILEEVSTVLKDTIQVVKIDTEEV 315 Q F E+L K T+ + + F G + VPILE+VS++L D IQVVKIDTE+ Sbjct: 71 QTFSSFEDLLEK--TDKPVLVDFYATWCGPC-QFMVPILEQVSSILVDKIQVVKIDTEKY 127 Query: 314 P 312 P Sbjct: 128 P 128 >ref|XP_004166624.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Cucumis sativus] Length = 74 Score = 53.5 bits (127), Expect(2) = 1e-10 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKPL 242 +YP IADKYRIEALPTFI+FKDGKPL Sbjct: 25 KYPAIADKYRIEALPTFILFKDGKPL 50 Score = 38.5 bits (88), Expect(2) = 1e-10 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPILE+VS L D +QVVKIDTE+ P Sbjct: 2 VPILEQVSAALIDKVQVVKIDTEKYP 27 >gb|ESW15539.1| hypothetical protein PHAVU_007G080600g [Phaseolus vulgaris] Length = 175 Score = 49.3 bits (116), Expect(2) = 2e-10 Identities = 20/25 (80%), Positives = 25/25 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +YP+IADKY+IEALPTFI+FKDG+P Sbjct: 126 KYPSIADKYKIEALPTFIMFKDGEP 150 Score = 42.0 bits (97), Expect(2) = 2e-10 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EVST LKD IQVVKIDTE+ P Sbjct: 103 VPILNEVSTRLKDKIQVVKIDTEKYP 128 >ref|XP_006300559.1| hypothetical protein CARUB_v10021037mg [Capsella rubella] gi|482569269|gb|EOA33457.1| hypothetical protein CARUB_v10021037mg [Capsella rubella] Length = 172 Score = 47.8 bits (112), Expect(2) = 2e-10 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +YP+IA+KY+IEALPTFI+FKDG+P Sbjct: 123 KYPSIANKYKIEALPTFILFKDGEP 147 Score = 43.1 bits (100), Expect(2) = 2e-10 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EVST LKD IQVVKIDTE+ P Sbjct: 100 VPILNEVSTTLKDKIQVVKIDTEKYP 125 >ref|XP_006300560.1| hypothetical protein CARUB_v10021037mg [Capsella rubella] gi|482569270|gb|EOA33458.1| hypothetical protein CARUB_v10021037mg [Capsella rubella] Length = 152 Score = 47.8 bits (112), Expect(2) = 2e-10 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +YP+IA+KY+IEALPTFI+FKDG+P Sbjct: 123 KYPSIANKYKIEALPTFILFKDGEP 147 Score = 43.1 bits (100), Expect(2) = 2e-10 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EVST LKD IQVVKIDTE+ P Sbjct: 100 VPILNEVSTTLKDKIQVVKIDTEKYP 125 >ref|XP_002889100.1| hypothetical protein ARALYDRAFT_476836 [Arabidopsis lyrata subsp. lyrata] gi|297334941|gb|EFH65359.1| hypothetical protein ARALYDRAFT_476836 [Arabidopsis lyrata subsp. lyrata] Length = 157 Score = 47.8 bits (112), Expect(2) = 9e-10 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +YP+IA+KY+IEALPTFI+FKDG+P Sbjct: 108 KYPSIANKYKIEALPTFILFKDGEP 132 Score = 41.2 bits (95), Expect(2) = 9e-10 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EVS LKD IQVVKIDTE+ P Sbjct: 85 VPILNEVSATLKDKIQVVKIDTEKYP 110 >ref|NP_177802.2| thioredoxin Y1 [Arabidopsis thaliana] gi|75324340|sp|Q6NPF9.1|TRXY1_ARATH RecName: Full=Thioredoxin Y1, chloroplastic; Short=AtTrxy1; Flags: Precursor gi|38454080|gb|AAR20734.1| At1g76760 [Arabidopsis thaliana] gi|38604000|gb|AAR24743.1| At1g76760 [Arabidopsis thaliana] gi|110743067|dbj|BAE99426.1| thioredoxin-like protein [Arabidopsis thaliana] gi|332197765|gb|AEE35886.1| thioredoxin Y1 [Arabidopsis thaliana] Length = 172 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +YP+IA+KY+IEALPTFI+FKDG+P Sbjct: 123 KYPSIANKYKIEALPTFILFKDGEP 147 Score = 40.8 bits (94), Expect(2) = 1e-09 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EVS LKD IQVVKIDTE+ P Sbjct: 100 VPILNEVSETLKDKIQVVKIDTEKYP 125 >gb|AAF04439.1|AC010718_8 thioredoxin-like protein; 49720-48645 [Arabidopsis thaliana] Length = 151 Score = 47.8 bits (112), Expect(2) = 1e-09 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +YP+IA+KY+IEALPTFI+FKDG+P Sbjct: 102 KYPSIANKYKIEALPTFILFKDGEP 126 Score = 40.8 bits (94), Expect(2) = 1e-09 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EVS LKD IQVVKIDTE+ P Sbjct: 79 VPILNEVSETLKDKIQVVKIDTEKYP 104 >gb|ESQ27443.1| hypothetical protein EUTSA_v10019218mg [Eutrema salsugineum] Length = 173 Score = 47.8 bits (112), Expect(2) = 2e-09 Identities = 19/25 (76%), Positives = 25/25 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +YP+IA+KY+IEALPTFI+FKDG+P Sbjct: 124 KYPSIANKYKIEALPTFILFKDGEP 148 Score = 40.4 bits (93), Expect(2) = 2e-09 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EVS +KD IQVVKIDTE+ P Sbjct: 101 VPILSEVSATMKDKIQVVKIDTEKYP 126 >gb|ESQ33275.1| hypothetical protein EUTSA_v10005020mg [Eutrema salsugineum] Length = 172 Score = 47.0 bits (110), Expect(2) = 3e-09 Identities = 19/24 (79%), Positives = 24/24 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGK 248 +YPT+A+KY+IEALPTFI+FKDGK Sbjct: 123 KYPTLANKYQIEALPTFILFKDGK 146 Score = 40.0 bits (92), Expect(2) = 3e-09 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -1 Query: 398 KLWVPILEEVSTVLKDTIQVVKIDTEEVP 312 +L VPIL EVS LKD I VVKIDTE+ P Sbjct: 97 QLMVPILNEVSETLKDKIAVVKIDTEKYP 125 >ref|XP_006305716.1| hypothetical protein CARUB_v10010465mg [Capsella rubella] gi|482574427|gb|EOA38614.1| hypothetical protein CARUB_v10010465mg [Capsella rubella] Length = 172 Score = 47.0 bits (110), Expect(2) = 6e-09 Identities = 19/24 (79%), Positives = 24/24 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGK 248 +YPT+A+KY+IEALPTFI+FKDGK Sbjct: 123 KYPTLANKYQIEALPTFILFKDGK 146 Score = 39.3 bits (90), Expect(2) = 6e-09 Identities = 19/29 (65%), Positives = 22/29 (75%) Frame = -1 Query: 398 KLWVPILEEVSTVLKDTIQVVKIDTEEVP 312 ++ VPIL EVS LKD I VVKIDTE+ P Sbjct: 97 QIMVPILNEVSETLKDKIAVVKIDTEKYP 125 >ref|XP_002524295.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] gi|223536386|gb|EEF38035.1| thioredoxin m(mitochondrial)-type, putative [Ricinus communis] Length = 170 Score = 65.9 bits (159), Expect = 7e-09 Identities = 42/99 (42%), Positives = 51/99 (51%), Gaps = 10/99 (10%) Frame = -3 Query: 435 VDFYATWCRFPVQIMGP----------NSGRSQYCSERHYPGGENRYRGGTLPLLTNTE* 286 VDFYATWC P Q+M P ++ + YP ++YR LP Sbjct: 84 VDFYATWCG-PCQLMTPILNEVSTILKDTIQVVKIDTEKYPSIADKYRIEALPTFI---- 138 Query: 285 KHCLHLSYLKMGNPYDRFEGAFSKDKFIQRIESSLQVKQ 169 K G PYDRFEGA +KD+FI+RIESSLQVKQ Sbjct: 139 -------IFKDGKPYDRFEGALAKDRFIERIESSLQVKQ 170 >gb|AAD39273.1|AC007203_5 Hypothetical protein [Arabidopsis thaliana] Length = 242 Score = 45.4 bits (106), Expect(2) = 9e-09 Identities = 18/24 (75%), Positives = 24/24 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGK 248 +YP++A+KY+IEALPTFI+FKDGK Sbjct: 193 KYPSLANKYQIEALPTFILFKDGK 216 Score = 40.0 bits (92), Expect(2) = 9e-09 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -1 Query: 398 KLWVPILEEVSTVLKDTIQVVKIDTEEVP 312 +L VPIL EVS LKD I VVKIDTE+ P Sbjct: 167 QLMVPILNEVSETLKDIIAVVKIDTEKYP 195 >ref|XP_002893945.1| hypothetical protein ARALYDRAFT_891327 [Arabidopsis lyrata subsp. lyrata] gi|297339787|gb|EFH70204.1| hypothetical protein ARALYDRAFT_891327 [Arabidopsis lyrata subsp. lyrata] Length = 174 Score = 45.4 bits (106), Expect(2) = 9e-09 Identities = 18/24 (75%), Positives = 24/24 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGK 248 +YP++A+KY+IEALPTFI+FKDGK Sbjct: 125 KYPSLANKYQIEALPTFILFKDGK 148 Score = 40.0 bits (92), Expect(2) = 9e-09 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -1 Query: 398 KLWVPILEEVSTVLKDTIQVVKIDTEEVP 312 +L VPIL EVS LKD I VVKIDTE+ P Sbjct: 99 QLMVPILNEVSETLKDKIAVVKIDTEKYP 127 >ref|NP_175021.2| thioredoxin Y2 [Arabidopsis thaliana] gi|75329782|sp|Q8L7S9.1|TRXY2_ARATH RecName: Full=Thioredoxin Y2, chloroplastic; Short=AtTrxy2; Flags: Precursor gi|22135797|gb|AAM91085.1| At1g43560/T10P12_4 [Arabidopsis thaliana] gi|48310619|gb|AAT41854.1| At1g43560 [Arabidopsis thaliana] gi|332193849|gb|AEE31970.1| thioredoxin Y2 [Arabidopsis thaliana] Length = 167 Score = 45.4 bits (106), Expect(2) = 9e-09 Identities = 18/24 (75%), Positives = 24/24 (100%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGK 248 +YP++A+KY+IEALPTFI+FKDGK Sbjct: 118 KYPSLANKYQIEALPTFILFKDGK 141 Score = 40.0 bits (92), Expect(2) = 9e-09 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -1 Query: 398 KLWVPILEEVSTVLKDTIQVVKIDTEEVP 312 +L VPIL EVS LKD I VVKIDTE+ P Sbjct: 92 QLMVPILNEVSETLKDIIAVVKIDTEKYP 120 >ref|XP_002302170.1| thioredoxin y [Populus trichocarpa] gi|222843896|gb|EEE81443.1| thioredoxin family protein [Populus trichocarpa] Length = 146 Score = 64.7 bits (156), Expect = 2e-08 Identities = 50/130 (38%), Positives = 61/130 (46%), Gaps = 10/130 (7%) Frame = -3 Query: 528 SNLAFGCRQRKPTISSLGGIGWKMPDQPGY*VDFYATWCRFPVQIMGPNSGRSQYCSE-- 355 S+L F +K T S+L + K D+P VDFYATWC P Q M P E Sbjct: 31 SSLQFPVAAKKQTFSTLDELLEKS-DKPVL-VDFYATWCG-PCQFMAPILNEVSAVLEDT 87 Query: 354 --------RHYPGGENRYRGGTLPLLTNTE*KHCLHLSYLKMGNPYDRFEGAFSKDKFIQ 199 YP ++YR LP K G PYDRFEGA +KD+ IQ Sbjct: 88 IQVVKIDTEKYPSIADKYRIEALPTFI-----------IFKDGKPYDRFEGALTKDQLIQ 136 Query: 198 RIESSLQVKQ 169 RIE+SL V+Q Sbjct: 137 RIENSLNVEQ 146 >ref|XP_002456987.1| hypothetical protein SORBIDRAFT_03g046830 [Sorghum bicolor] gi|241928962|gb|EES02107.1| hypothetical protein SORBIDRAFT_03g046830 [Sorghum bicolor] Length = 171 Score = 46.6 bits (109), Expect(2) = 3e-08 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +Y +IA +YRIEALPTFIIFKDGKP Sbjct: 122 KYTSIASRYRIEALPTFIIFKDGKP 146 Score = 37.0 bits (84), Expect(2) = 3e-08 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEE 318 VPILEEVS L D IQVVKIDTE+ Sbjct: 99 VPILEEVSEKLGDKIQVVKIDTEK 122 >ref|NP_001168881.1| putative thioredoxin superfamily protein [Zea mays] gi|223973467|gb|ACN30921.1| unknown [Zea mays] gi|414878599|tpg|DAA55730.1| TPA: putative thioredoxin superfamily protein [Zea mays] Length = 167 Score = 46.6 bits (109), Expect(2) = 8e-08 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDGKP 245 +Y +IA +YRIEALPTFIIFKDGKP Sbjct: 118 KYTSIASRYRIEALPTFIIFKDGKP 142 Score = 35.8 bits (81), Expect(2) = 8e-08 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEE 318 VPIL+EVS L D IQVVKIDTE+ Sbjct: 95 VPILQEVSEKLGDKIQVVKIDTEK 118 >ref|XP_004237802.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Solanum lycopersicum] Length = 174 Score = 44.3 bits (103), Expect(2) = 1e-07 Identities = 17/23 (73%), Positives = 22/23 (95%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDG 251 +YP +ADKY+I+ALPTFI+FKDG Sbjct: 125 KYPALADKYKIQALPTFILFKDG 147 Score = 37.7 bits (86), Expect(2) = 1e-07 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EV +KD IQVVKIDTE+ P Sbjct: 102 VPILNEVGESMKDKIQVVKIDTEKYP 127 >ref|XP_006359806.1| PREDICTED: thioredoxin Y1, chloroplastic-like [Solanum tuberosum] Length = 170 Score = 44.3 bits (103), Expect(2) = 1e-07 Identities = 17/23 (73%), Positives = 22/23 (95%) Frame = -2 Query: 319 RYPTIADKYRIEALPTFIIFKDG 251 +YP +ADKY+I+ALPTFI+FKDG Sbjct: 121 KYPALADKYKIQALPTFILFKDG 143 Score = 37.7 bits (86), Expect(2) = 1e-07 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 389 VPILEEVSTVLKDTIQVVKIDTEEVP 312 VPIL EV +KD IQVVKIDTE+ P Sbjct: 98 VPILNEVGESMKDKIQVVKIDTEKYP 123