BLASTX nr result
ID: Jatropha_contig00011159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011159 (384 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67170.1| hypothetical protein [Jatropha curcas] 61 1e-07 >gb|ADJ67170.1| hypothetical protein [Jatropha curcas] Length = 83 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -2 Query: 203 GAPGSGFGLMNVVWSFEFLLLPRARQFYSISK 108 GA GSGFGLMNV WSFEFLLLPRA QFYSISK Sbjct: 52 GATGSGFGLMNVGWSFEFLLLPRAMQFYSISK 83