BLASTX nr result
ID: Jatropha_contig00011131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011131 (647 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67184.1| hypothetical protein [Jatropha curcas] 72 2e-16 >gb|ADJ67184.1| hypothetical protein [Jatropha curcas] Length = 118 Score = 71.6 bits (174), Expect(3) = 2e-16 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -2 Query: 499 TTLAATVNDALWENGDRCKQTLKVRCIKSTDASKPCKRHTSV 374 TTL ATVNDALWENGDRC L + IKSTDASKPCKRHTSV Sbjct: 76 TTLVATVNDALWENGDRCIYILTLTRIKSTDASKPCKRHTSV 117 Score = 31.6 bits (70), Expect(3) = 2e-16 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 533 PNQCYGDDPLP 501 PNQCYGDDPLP Sbjct: 65 PNQCYGDDPLP 75 Score = 28.9 bits (63), Expect(3) = 2e-16 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 564 TVSVYDPPYTP 532 TVSVYDPPYTP Sbjct: 55 TVSVYDPPYTP 65