BLASTX nr result
ID: Jatropha_contig00011051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011051 (475 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU56193.1| hypothetical protein [Jatropha curcas] 88 2e-32 gb|ADJ67204.1| hypothetical protein [Jatropha curcas] 89 6e-16 >gb|ADU56193.1| hypothetical protein [Jatropha curcas] Length = 102 Score = 88.2 bits (217), Expect(2) = 2e-32 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 NTACLHLECFLLGCFPILHLEYFLPECYPILRLEYFRL 240 NTACLHLECFLLGCFPILHLEYFLPECYPILRLEYFRL Sbjct: 26 NTACLHLECFLLGCFPILHLEYFLPECYPILRLEYFRL 63 Score = 76.6 bits (187), Expect(2) = 2e-32 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 235 YYHILRLECFLPEYCHHLHPAYFLPGCYPI 146 YYHILRLECFLPEYCHHLHPAYFLPGCYPI Sbjct: 65 YYHILRLECFLPEYCHHLHPAYFLPGCYPI 94 >gb|ADJ67204.1| hypothetical protein [Jatropha curcas] Length = 84 Score = 89.0 bits (219), Expect = 6e-16 Identities = 47/71 (66%), Positives = 50/71 (70%), Gaps = 13/71 (18%) Frame = +3 Query: 240 KAEILKAEDGVTLREEILKVEDGETPKEETLKVE-------------AGGVRDNTYEGNT 380 KAEILK EDG TL+ E LKVEDGE KEETLKVE GG RDNT+EGNT Sbjct: 5 KAEILKVEDGATLKVETLKVEDGEILKEETLKVEDMVIPRVETLKVGGGGTRDNTFEGNT 64 Query: 381 QNDGGYGNTRE 413 Q+DGGYGNTRE Sbjct: 65 QDDGGYGNTRE 75