BLASTX nr result
ID: Jatropha_contig00011035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011035 (233 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67195.1| hypothetical protein [Jatropha curcas] 99 6e-19 >gb|ADJ67195.1| hypothetical protein [Jatropha curcas] Length = 59 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/53 (83%), Positives = 45/53 (84%) Frame = +1 Query: 58 KLPKWRKNHGRCQRTIKKNIHYAAKCYNHNYKIFFYPTPSKHPKYFIL*GIPK 216 K P+ KNH RCQ TIKKNIHYAA CYNHNYKIFFY TPSKHPKYFIL GIPK Sbjct: 3 KTPQVEKNHDRCQTTIKKNIHYAANCYNHNYKIFFYLTPSKHPKYFILQGIPK 55