BLASTX nr result
ID: Jatropha_contig00011004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00011004 (435 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67212.1| hypothetical protein [Jatropha curcas] 62 1e-07 gb|ADJ67176.1| hypothetical protein [Jatropha curcas] 62 1e-07 >gb|ADJ67212.1| hypothetical protein [Jatropha curcas] Length = 78 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 73 MKKAFLLICILLATISLSPSLTSARELAAIGK 168 MKKAFLLICILLATISLSPSLTSARELAAIGK Sbjct: 1 MKKAFLLICILLATISLSPSLTSARELAAIGK 32 >gb|ADJ67176.1| hypothetical protein [Jatropha curcas] Length = 105 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 167 FPIAANSLAEVREGEREMVAKRMQIRRKAFFI 72 FPIAANSLAEVREGEREMV KRMQ+RRKAFFI Sbjct: 74 FPIAANSLAEVREGEREMVVKRMQMRRKAFFI 105