BLASTX nr result
ID: Jatropha_contig00010871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010871 (499 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY15869.1| Auxin efflux carrier family protein, putative [Th... 64 2e-08 gb|ESR48704.1| hypothetical protein CICLE_v10001325mg [Citrus cl... 63 3e-08 gb|ESR48703.1| hypothetical protein CICLE_v10001325mg [Citrus cl... 63 3e-08 ref|XP_002528528.1| auxin:hydrogen symporter, putative [Ricinus ... 63 3e-08 gb|EMJ12469.1| hypothetical protein PRUPE_ppa017924mg [Prunus pe... 62 1e-07 gb|EMJ10387.1| hypothetical protein PRUPE_ppa006413mg [Prunus pe... 62 1e-07 ref|XP_004300092.1| PREDICTED: uncharacterized transporter YBR28... 61 1e-07 ref|XP_002263495.2| PREDICTED: uncharacterized protein LOC100260... 61 2e-07 ref|XP_003629048.1| Transporter, putative [Medicago truncatula] ... 61 2e-07 emb|CBI37490.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_003534224.1| PREDICTED: uncharacterized protein LOC100810... 60 2e-07 ref|XP_006302565.1| hypothetical protein CARUB_v10020672mg [Caps... 60 4e-07 ref|XP_002887644.1| hypothetical protein ARALYDRAFT_895536 [Arab... 60 4e-07 ref|XP_002526514.1| auxin:hydrogen symporter, putative [Ricinus ... 60 4e-07 ref|XP_002528529.1| auxin:hydrogen symporter, putative [Ricinus ... 60 4e-07 gb|AAM62517.1| unknown [Arabidopsis thaliana] 60 4e-07 gb|ESW28264.1| hypothetical protein PHAVU_003G272300g [Phaseolus... 59 5e-07 gb|ERP67315.1| hypothetical protein POPTR_0001s46050g [Populus t... 59 5e-07 ref|XP_004512295.1| PREDICTED: uncharacterized protein LOC101507... 59 5e-07 ref|XP_004512294.1| PREDICTED: uncharacterized protein LOC101507... 59 5e-07 >gb|EOY15869.1| Auxin efflux carrier family protein, putative [Theobroma cacao] Length = 436 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA AS+SLTLWSTFF+W++A Sbjct: 405 GESECSVIMLWTYALASISLTLWSTFFMWLVA 436 >gb|ESR48704.1| hypothetical protein CICLE_v10001325mg [Citrus clementina] Length = 412 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA ASVS+TLWSTFFLW+++ Sbjct: 381 GESECSVIMLWTYALASVSITLWSTFFLWLVS 412 >gb|ESR48703.1| hypothetical protein CICLE_v10001325mg [Citrus clementina] Length = 338 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA ASVS+TLWSTFFLW+++ Sbjct: 307 GESECSVIMLWTYALASVSITLWSTFFLWLVS 338 >ref|XP_002528528.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223532030|gb|EEF33840.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 417 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWML 100 GQSECSVIMLWTYA AS+SLTLWST FLWM+ Sbjct: 386 GQSECSVIMLWTYAMASISLTLWSTLFLWMV 416 >gb|EMJ12469.1| hypothetical protein PRUPE_ppa017924mg [Prunus persica] Length = 423 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+ ECSVIMLWTYAFASVSLT WS FF+W++A Sbjct: 390 GEKECSVIMLWTYAFASVSLTFWSAFFMWLVA 421 >gb|EMJ10387.1| hypothetical protein PRUPE_ppa006413mg [Prunus persica] Length = 413 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+ ECSVIMLWTYAFASVSLT WS FF+W++A Sbjct: 380 GEKECSVIMLWTYAFASVSLTFWSAFFMWLVA 411 >ref|XP_004300092.1| PREDICTED: uncharacterized transporter YBR287W-like [Fragaria vesca subsp. vesca] Length = 413 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVI+LWTY FASVSLTLWS FF+W +A Sbjct: 380 GESECSVILLWTYVFASVSLTLWSAFFMWFVA 411 >ref|XP_002263495.2| PREDICTED: uncharacterized protein LOC100260227 [Vitis vinifera] Length = 387 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA ASV+LTLWST F+W++A Sbjct: 356 GESECSVIMLWTYALASVALTLWSTLFMWLVA 387 >ref|XP_003629048.1| Transporter, putative [Medicago truncatula] gi|355523070|gb|AET03524.1| Transporter, putative [Medicago truncatula] Length = 403 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = +2 Query: 5 GGQSECSVIMLWTYAFASVSLTLWSTFFLWML 100 GG+SECSVIMLW+YA AS+++TLWSTFF+W++ Sbjct: 371 GGESECSVIMLWSYALASIAVTLWSTFFMWLV 402 >emb|CBI37490.3| unnamed protein product [Vitis vinifera] Length = 459 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA ASV+LTLWST F+W++A Sbjct: 428 GESECSVIMLWTYALASVALTLWSTLFMWLVA 459 >ref|XP_003534224.1| PREDICTED: uncharacterized protein LOC100810166 [Glycine max] Length = 414 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/32 (71%), Positives = 31/32 (96%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA AS+++TLWSTFF+W+++ Sbjct: 383 GESECSVIMLWTYALASIAVTLWSTFFMWLVS 414 >ref|XP_006302565.1| hypothetical protein CARUB_v10020672mg [Capsella rubella] gi|482571275|gb|EOA35463.1| hypothetical protein CARUB_v10020672mg [Capsella rubella] Length = 318 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTY+ AS+SLT+W TFF+W++A Sbjct: 287 GESECSVIMLWTYSLASISLTVWPTFFMWLVA 318 >ref|XP_002887644.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. lyrata] gi|297333485|gb|EFH63903.1| hypothetical protein ARALYDRAFT_895536 [Arabidopsis lyrata subsp. lyrata] Length = 391 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTY+ AS+SLT+W TFF+W++A Sbjct: 360 GESECSVIMLWTYSLASISLTVWPTFFMWLVA 391 >ref|XP_002526514.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223534189|gb|EEF35905.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 434 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA ASVS+TLWS FF+W+++ Sbjct: 403 GESECSVIMLWTYAVASVSVTLWSAFFMWLVS 434 >ref|XP_002528529.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223532031|gb|EEF33841.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 447 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWML 100 G+SECSVI+LW+YA ASVSLTLWSTFF+W++ Sbjct: 416 GESECSVILLWSYAVASVSLTLWSTFFMWLV 446 >gb|AAM62517.1| unknown [Arabidopsis thaliana] Length = 390 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTY+ AS+SLT+W TFF+W++A Sbjct: 359 GESECSVIMLWTYSLASISLTVWPTFFMWLVA 390 >gb|ESW28264.1| hypothetical protein PHAVU_003G272300g [Phaseolus vulgaris] Length = 414 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/32 (68%), Positives = 31/32 (96%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA A++++TLWSTFF+W+++ Sbjct: 383 GESECSVIMLWTYALAAIAVTLWSTFFMWLVS 414 >gb|ERP67315.1| hypothetical protein POPTR_0001s46050g [Populus trichocarpa] Length = 428 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA AS+ LTLWST F+W++A Sbjct: 397 GESECSVIMLWTYALASIFLTLWSTLFMWLVA 428 >ref|XP_004512295.1| PREDICTED: uncharacterized protein LOC101507155 isoform X2 [Cicer arietinum] Length = 344 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/32 (68%), Positives = 31/32 (96%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA AS+++TLWST+F+W+++ Sbjct: 313 GESECSVIMLWTYALASIAVTLWSTYFMWLVS 344 >ref|XP_004512294.1| PREDICTED: uncharacterized protein LOC101507155 isoform X1 [Cicer arietinum] Length = 365 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/32 (68%), Positives = 31/32 (96%) Frame = +2 Query: 8 GQSECSVIMLWTYAFASVSLTLWSTFFLWMLA 103 G+SECSVIMLWTYA AS+++TLWST+F+W+++ Sbjct: 334 GESECSVIMLWTYALASIAVTLWSTYFMWLVS 365