BLASTX nr result
ID: Jatropha_contig00010857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010857 (570 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67184.1| hypothetical protein [Jatropha curcas] 66 2e-10 >gb|ADJ67184.1| hypothetical protein [Jatropha curcas] Length = 118 Score = 66.2 bits (160), Expect(2) = 2e-10 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -2 Query: 485 ATVNDALWENGDRCKQTLRVRCIKSTDASKPCKRHTSV 372 ATVNDALWENGDRC L + IKSTDASKPCKRHTSV Sbjct: 80 ATVNDALWENGDRCIYILTLTRIKSTDASKPCKRHTSV 117 Score = 25.0 bits (53), Expect(2) = 2e-10 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 559 TVSVLESTLPSHQCYGDD 506 TVSV + +QCYGDD Sbjct: 55 TVSVYDPPYTPNQCYGDD 72