BLASTX nr result
ID: Jatropha_contig00010851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010851 (129 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318750.1| predicted protein [Populus trichocarpa] 62 3e-08 >ref|XP_002318750.1| predicted protein [Populus trichocarpa] Length = 59 Score = 62.0 bits (149), Expect(2) = 3e-08 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 2 SSDIVIHNIDQTRYHRDGIHPIEFRGERLIIPMGLNPELL 121 SSDIVIH+ID RYHRDGIHPIEFRGER +I G+ ++ Sbjct: 18 SSDIVIHDIDLIRYHRDGIHPIEFRGERFLISYGIKSRII 57 Score = 21.2 bits (43), Expect(2) = 3e-08 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 97 YGIKSRVIAK 126 YGIKSR+I K Sbjct: 50 YGIKSRIIVK 59