BLASTX nr result
ID: Jatropha_contig00010669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010669 (336 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514629.1| Protein COBRA precursor, putative [Ricinus c... 61 1e-07 >ref|XP_002514629.1| Protein COBRA precursor, putative [Ricinus communis] gi|223546233|gb|EEF47735.1| Protein COBRA precursor, putative [Ricinus communis] Length = 383 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +1 Query: 1 PPPDAYPWLPNDGSRQLVSLFRPIMTFLVYIVIIS 105 PPPDAYPWLPND SR + SLF P+M FLVYIV S Sbjct: 346 PPPDAYPWLPNDSSRTIFSLFLPLMAFLVYIVFFS 380