BLASTX nr result
ID: Jatropha_contig00010578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010578 (351 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521002.1| cytochrome P450, putative [Ricinus communis]... 60 5e-09 sp|O81117.2|C94A1_VICSA RecName: Full=Cytochrome P450 94A1; AltN... 53 3e-06 >ref|XP_002521002.1| cytochrome P450, putative [Ricinus communis] gi|223539839|gb|EEF41419.1| cytochrome P450, putative [Ricinus communis] Length = 497 Score = 60.1 bits (144), Expect(2) = 5e-09 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 114 YQAEKMAGRDAVNEKWNFVGRDSYIYLNFQAGPRICLG 1 ++ E+ RD VNEKWNFVGRD+Y Y FQAGPRICLG Sbjct: 406 FKPERWLERDIVNEKWNFVGRDAYTYPVFQAGPRICLG 443 Score = 25.8 bits (55), Expect(2) = 5e-09 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 131 GYDWVDIKPKKWPE 90 G DW D KP++W E Sbjct: 400 GADWADFKPERWLE 413 >sp|O81117.2|C94A1_VICSA RecName: Full=Cytochrome P450 94A1; AltName: Full=P450-dependent fatty acid omega-hydroxylase gi|4204095|gb|AAD10204.1| CYP94A1 [Vicia sativa] Length = 514 Score = 53.1 bits (126), Expect(2) = 3e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -1 Query: 114 YQAEKMAGRDAVNEKWNFVGRDSYIYLNFQAGPRICLG 1 ++ E+ +D VN KW FVGRDSY Y FQAGPR+CLG Sbjct: 423 FRPERWLEKDEVNGKWVFVGRDSYSYPVFQAGPRVCLG 460 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -2 Query: 131 GYDWVDIKPKKWPEE 87 G DW + +P++W E+ Sbjct: 417 GDDWAEFRPERWLEK 431