BLASTX nr result
ID: Jatropha_contig00010566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010566 (344 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524888.1| conserved hypothetical protein [Ricinus comm... 59 1e-08 >ref|XP_002524888.1| conserved hypothetical protein [Ricinus communis] gi|223535851|gb|EEF37512.1| conserved hypothetical protein [Ricinus communis] Length = 100 Score = 59.3 bits (142), Expect(2) = 1e-08 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +2 Query: 5 WCCIKLPCKIGWRAAKHACGRYWTCCGSKKKV 100 WCC+KLPCKIGW+AAK+ R+W CCGS++KV Sbjct: 38 WCCVKLPCKIGWKAAKNV--RHWICCGSQEKV 67 Score = 25.4 bits (54), Expect(2) = 1e-08 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 141 VCLVKRENLKAVIRLRRPD*SLELMNCNVEGLL 239 +C +E + + L D L + +CNVEGLL Sbjct: 59 ICCGSQEKVDLMAVLGLQDIGLHIEDCNVEGLL 91