BLASTX nr result
ID: Jatropha_contig00010281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010281 (706 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_023620233.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023617672.1| 2-methylthioadenine synthetase, partial [Ent... 65 2e-08 ref|WP_023566650.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023481461.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023339831.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023336976.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023335043.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023324375.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023320625.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023310913.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023299671.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023288970.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023246525.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023239868.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023239685.1| ribosomal protein S12 methylthiotransferase,... 65 2e-08 ref|WP_023229003.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023221582.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023217154.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023215090.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 ref|WP_023200411.1| ribosomal protein S12 methylthiotransferase ... 65 2e-08 >ref|WP_023620233.1| ribosomal protein S12 methylthiotransferase [Enterobacter cloacae] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023617672.1| 2-methylthioadenine synthetase, partial [Enterobacter sp. MR1] Length = 205 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023566650.1| ribosomal protein S12 methylthiotransferase [Escherichia coli] gi|558736009|gb|EST84636.1| ribosomal protein S12 methylthiotransferase [Escherichia coli ECC-1470] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023481461.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter cloacae] gi|557852547|gb|ESS56462.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter cloacae S611] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023339831.1| ribosomal protein S12 methylthiotransferase RimO [Klebsiella pneumoniae] gi|555202956|gb|ESN45344.1| ribosomal protein S12 methylthiotransferase RimO [Klebsiella pneumoniae MGH 20] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023336976.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter cloacae complex] gi|555183753|gb|ESN26299.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter sp. MGH 23] gi|555186503|gb|ESN28450.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter sp. MGH 22] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023335043.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter sp. MGH 24] gi|555169857|gb|ESN12490.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter sp. MGH 24] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023324375.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter sp. MGH 38] gi|555136869|gb|ESM79638.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter sp. MGH 38] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023320625.1| ribosomal protein S12 methylthiotransferase RimO [Klebsiella oxytoca] gi|555134398|gb|ESM77204.1| ribosomal protein S12 methylthiotransferase RimO [Klebsiella oxytoca MGH 42] gi|555161533|gb|ESN04226.1| ribosomal protein S12 methylthiotransferase RimO [Klebsiella oxytoca MGH 28] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023310913.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter cloacae] gi|555088717|gb|ESM31862.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter cloacae BWH 31] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023299671.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter cloacae] gi|555043640|gb|ESL87940.1| ribosomal protein S12 methylthiotransferase RimO [Enterobacter cloacae UCICRE 9] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023288970.1| ribosomal protein S12 methylthiotransferase RimO [Klebsiella pneumoniae] gi|555033538|gb|ESL77873.1| ribosomal protein S12 methylthiotransferase RimO [Klebsiella pneumoniae UCICRE 14] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023246525.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica] gi|554389170|gb|ESJ20902.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. diarizonae serovar 60:r:e,n,x,z15 str. 01-0170] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023239868.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica] gi|554322860|gb|ESH59357.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000200] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023239685.1| ribosomal protein S12 methylthiotransferase, partial [Salmonella enterica] gi|554314788|gb|ESH51103.1| ribosomal protein S12 methylthiotransferase, partial [Salmonella enterica subsp. enterica serovar Bareilly str. 2780] Length = 48 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023229003.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica] gi|554298637|gb|ESH34753.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Gaminara str. ATCC BAA-711] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023221582.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica] gi|554205017|gb|ESG43306.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Muenchen str. baa1674] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023217154.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica] gi|554192625|gb|ESG31358.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Minnesota str. ATCC 49284] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023215090.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica] gi|554174509|gb|ESG13861.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Oranienburg str. 701] gi|554175318|gb|ESG14629.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Oranienburg str. 0250] gi|556540760|gb|ESP73240.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Saintpaul str. S-70] gi|556546532|gb|ESP78532.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Oranienburg str. S-76] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37 >ref|WP_023200411.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica] gi|554087021|gb|ESF29384.1| ribosomal protein S12 methylthiotransferase [Salmonella enterica subsp. enterica serovar Tallahassee str. 0012] Length = 441 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 704 PKIGFVSLGCPKNLVDSERILTELRTEGYD 615 PKIGFVSLGCPKNLVDSERILTELRTEGYD Sbjct: 8 PKIGFVSLGCPKNLVDSERILTELRTEGYD 37