BLASTX nr result
ID: Jatropha_contig00010185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010185 (362 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528812.1| oligopeptide transporter, putative [Ricinus ... 75 8e-12 gb|EOY06133.1| Peptide transporter PTR3-A [Theobroma cacao] 64 3e-08 gb|ESR46791.1| hypothetical protein CICLE_v10003924mg [Citrus cl... 63 4e-08 ref|XP_002314492.1| predicted protein [Populus trichocarpa] gi|2... 63 4e-08 gb|ESR33541.1| hypothetical protein CICLE_v10004592mg [Citrus cl... 61 1e-07 gb|ESR33545.1| hypothetical protein CICLE_v10004600mg [Citrus cl... 60 2e-07 gb|ESR33544.1| hypothetical protein CICLE_v10004600mg [Citrus cl... 60 2e-07 gb|ESR33543.1| hypothetical protein CICLE_v10004600mg [Citrus cl... 60 2e-07 gb|EEE89056.2| proton-dependent oligopeptide transport family pr... 59 6e-07 gb|ESR33560.1| hypothetical protein CICLE_v10006425mg [Citrus cl... 56 4e-06 >ref|XP_002528812.1| oligopeptide transporter, putative [Ricinus communis] gi|223531724|gb|EEF33546.1| oligopeptide transporter, putative [Ricinus communis] Length = 564 Score = 75.1 bits (183), Expect = 8e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQEVSDT 130 F FFLVVIKFYVYKAE SDSMEVLA++LKGMRL+AP+QEVS+T Sbjct: 519 FLFFLVVIKFYVYKAEASDSMEVLAEQLKGMRLQAPNQEVSNT 561 >gb|EOY06133.1| Peptide transporter PTR3-A [Theobroma cacao] Length = 512 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQEVS 124 F FFLVVIKFYVYKAEVSDS+ VL +ELK MRLKA +QE S Sbjct: 470 FIFFLVVIKFYVYKAEVSDSLHVLTEELKVMRLKASNQEES 510 >gb|ESR46791.1| hypothetical protein CICLE_v10003924mg [Citrus clementina] Length = 595 Score = 62.8 bits (151), Expect = 4e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQEVS 124 F FFLVV KFYVYKAEVSDSMEVL +ELK MRL+A +QE + Sbjct: 552 FVFFLVVAKFYVYKAEVSDSMEVLTEELKVMRLRASAQEAT 592 >ref|XP_002314492.1| predicted protein [Populus trichocarpa] gi|222863532|gb|EEF00663.1| proton-dependent oligopeptide transport family protein [Populus trichocarpa] Length = 589 Score = 62.8 bits (151), Expect = 4e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQ 115 F FFL VI+FYVYKAEVSDSMEVLA+ELK MRL+ P+Q Sbjct: 548 FIFFLGVIRFYVYKAEVSDSMEVLAEELKAMRLREPNQ 585 >gb|ESR33541.1| hypothetical protein CICLE_v10004592mg [Citrus clementina] Length = 595 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQEVS 124 F FFLVV KFYVYKAEVSDSMEVL +ELK MRL+A +Q+ + Sbjct: 552 FVFFLVVAKFYVYKAEVSDSMEVLTEELKVMRLRASAQKAT 592 >gb|ESR33545.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] Length = 592 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQEVS 124 F FFLVV KFYVYKAEVSDSMEVL +ELK MR +A +QE + Sbjct: 549 FVFFLVVAKFYVYKAEVSDSMEVLTEELKVMRSRASAQEAT 589 >gb|ESR33544.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] Length = 482 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQEVS 124 F FFLVV KFYVYKAEVSDSMEVL +ELK MR +A +QE + Sbjct: 439 FVFFLVVAKFYVYKAEVSDSMEVLTEELKVMRSRASAQEAT 479 >gb|ESR33543.1| hypothetical protein CICLE_v10004600mg [Citrus clementina] Length = 549 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQEVS 124 F FFLVV KFYVYKAEVSDSMEVL +ELK MR +A +QE + Sbjct: 506 FVFFLVVAKFYVYKAEVSDSMEVLTEELKVMRSRASAQEAT 546 >gb|EEE89056.2| proton-dependent oligopeptide transport family protein [Populus trichocarpa] Length = 590 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQ 115 F FFL+V + YVYKAEVSDSMEVLA+ELKGM L P+Q Sbjct: 548 FIFFLIVNRLYVYKAEVSDSMEVLAEELKGMTLTEPNQ 585 >gb|ESR33560.1| hypothetical protein CICLE_v10006425mg [Citrus clementina] Length = 570 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 2 FFFFLVVIKFYVYKAEVSDSMEVLAQELKGMRLKAPSQEVS 124 F FFLV+ KFYVYK EVS+S+EVL +ELK MRL+A +QE + Sbjct: 527 FVFFLVMAKFYVYKTEVSNSIEVLIEELKVMRLRASAQEAT 567