BLASTX nr result
ID: Jatropha_contig00010162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010162 (695 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515328.1| nutrient reservoir, putative [Ricinus commun... 68 3e-09 ref|XP_002320322.1| predicted protein [Populus trichocarpa] 57 5e-06 >ref|XP_002515328.1| nutrient reservoir, putative [Ricinus communis] gi|223545808|gb|EEF47312.1| nutrient reservoir, putative [Ricinus communis] Length = 176 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/60 (50%), Positives = 37/60 (61%) Frame = +3 Query: 408 YEPPAGGEFYAPPGSGYGTNPTPYFPNYMPPQPSSATDYVHLKLMPMIIAVLVSFTALCC 587 Y PP G+FYAPPG GYG NP PYF +Y PSSA + L L + A+ +S +LCC Sbjct: 116 YSPPGSGQFYAPPGPGYGNNPKPYFSDY---NPSSAFNSARLTLEMAVFAIFLSLISLCC 172 >ref|XP_002320322.1| predicted protein [Populus trichocarpa] Length = 184 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = +3 Query: 408 YEPPAGGEFYAPPGSGYGTNPTPYFP--NYMPPQPSSATDYVHLKLMPMIIAVLVSFTAL 581 Y P AG F PP +GYG NP PYFP N PP PS + VHLKL +++ + +S T L Sbjct: 124 YWPGAGYSFNGPP-AGYGNNPVPYFPFDNNNPP-PSFSFKSVHLKLQSIVLCIFLSLTFL 181 Query: 582 CCF 590 C F Sbjct: 182 CFF 184