BLASTX nr result
ID: Jatropha_contig00010142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00010142 (524 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530192.1| ETHYLENE-INSENSITIVE3 protein, putative [Ric... 66 5e-09 gb|EOY34301.1| Ethylene insensitive 3 family protein [Theobroma ... 59 8e-07 ref|XP_002328098.1| ethylene-insensitive 3b [Populus trichocarpa... 58 1e-06 gb|EEE86796.2| EIN3-like family protein [Populus trichocarpa] 56 4e-06 ref|XP_002312841.1| ethylene-insensitive 3a [Populus trichocarpa] 56 4e-06 >ref|XP_002530192.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis] gi|223530285|gb|EEF32182.1| ETHYLENE-INSENSITIVE3 protein, putative [Ricinus communis] Length = 617 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 GSPFDLASFDYKEDLQGLVMDALPKQQDVSIWFQ 102 GSPFDL+SFDYKEDLQGL M++LPKQQD +IWFQ Sbjct: 584 GSPFDLSSFDYKEDLQGLAMESLPKQQDAAIWFQ 617 >gb|EOY34301.1| Ethylene insensitive 3 family protein [Theobroma cacao] Length = 615 Score = 58.5 bits (140), Expect = 8e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 GSPFDLASFDYKEDLQGLVMDALPKQQDVSIWFQ 102 GSPFDLASFDYKEDLQ + MD LPK QDVS+WFQ Sbjct: 583 GSPFDLASFDYKEDLQAVGMDTLPK-QDVSMWFQ 615 >ref|XP_002328098.1| ethylene-insensitive 3b [Populus trichocarpa] gi|550341526|gb|ERP62555.1| EIN3-like family protein [Populus trichocarpa] Length = 617 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +1 Query: 1 GSPFDLASFDYKEDLQGLVMDALPKQQDVSIWF 99 GSPFDL+SFDYK+DLQ L MD LPK QDVS WF Sbjct: 585 GSPFDLSSFDYKDDLQVLGMDTLPKHQDVSTWF 617 >gb|EEE86796.2| EIN3-like family protein [Populus trichocarpa] Length = 625 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 4 SPFDLASFDYKEDLQGLVMDALPK-QQDVSIWF 99 SP DL+SF+YKEDLQGL MD+LPK QQDVSIWF Sbjct: 593 SPLDLSSFEYKEDLQGLGMDSLPKHQQDVSIWF 625 >ref|XP_002312841.1| ethylene-insensitive 3a [Populus trichocarpa] Length = 631 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/33 (81%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +1 Query: 4 SPFDLASFDYKEDLQGLVMDALPK-QQDVSIWF 99 SP DL+SF+YKEDLQGL MD+LPK QQDVSIWF Sbjct: 599 SPLDLSSFEYKEDLQGLGMDSLPKHQQDVSIWF 631