BLASTX nr result
ID: Jatropha_contig00009844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00009844 (193 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154316.1| PREDICTED: uncharacterized protein LOC101218... 64 2e-11 ref|XP_002489033.1| hypothetical protein SORBIDRAFT_0351s002020 ... 63 3e-08 ref|XP_002489041.1| hypothetical protein SORBIDRAFT_0285s002020 ... 43 5e-07 ref|XP_724982.1| hypothetical protein [Plasmodium yoelii yoelii ... 58 1e-06 emb|CCD58743.1| unnamed protein product [Schistosoma mansoni] 57 2e-06 ref|XP_002488947.1| hypothetical protein SORBIDRAFT_1368s002010 ... 40 3e-06 gb|ABI52743.1| 10 kDa putative secreted protein [Argas monolaken... 55 9e-06 >ref|XP_004154316.1| PREDICTED: uncharacterized protein LOC101218508, partial [Cucumis sativus] Length = 108 Score = 64.3 bits (155), Expect(2) = 2e-11 Identities = 31/42 (73%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +2 Query: 26 WSWKSKSAKECVTTHLPNQLAPKMDGA*RATI-PASGQEPAP 148 WSWKSKSAKECVTTHLPNQLAPKMDGA + PA G P Sbjct: 14 WSWKSKSAKECVTTHLPNQLAPKMDGAEACDLYPAVGARARP 55 Score = 29.6 bits (65), Expect(2) = 2e-11 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 135 KSQPR*VGGRGGRCKTRG 188 +++PR VGG GGRCKT G Sbjct: 52 RARPRYVGGCGGRCKTLG 69 >ref|XP_002489033.1| hypothetical protein SORBIDRAFT_0351s002020 [Sorghum bicolor] gi|241947330|gb|EES20475.1| hypothetical protein SORBIDRAFT_0351s002020 [Sorghum bicolor] Length = 55 Score = 63.2 bits (152), Expect = 3e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 26 WSWKSKSAKECVTTHLPNQLAPKMDGA 106 WSWKSKSAKECVTTHLPNQLAPKMDGA Sbjct: 13 WSWKSKSAKECVTTHLPNQLAPKMDGA 39 >ref|XP_002489041.1| hypothetical protein SORBIDRAFT_0285s002020 [Sorghum bicolor] gi|241947306|gb|EES20451.1| hypothetical protein SORBIDRAFT_0285s002020 [Sorghum bicolor] Length = 67 Score = 42.7 bits (99), Expect(2) = 5e-07 Identities = 18/20 (90%), Positives = 20/20 (100%) Frame = -3 Query: 110 VKRHPFSGLVDSAGELLHTP 51 ++RHPFSGLVDSAGELLHTP Sbjct: 48 LQRHPFSGLVDSAGELLHTP 67 Score = 36.6 bits (83), Expect(2) = 5e-07 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 192 SRPGFCSDRRALLLIGAGSCP 130 SRPGFCS RRALLLIGA P Sbjct: 19 SRPGFCSGRRALLLIGAWRSP 39 >ref|XP_724982.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL] gi|23479818|gb|EAA16547.1| hypothetical protein [Plasmodium yoelii yoelii] Length = 124 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +2 Query: 26 WSWKSKSAKECVTTHLPNQLAPKMDGA 106 WSWKSKSAKECVTTHLPN+LA KMDGA Sbjct: 6 WSWKSKSAKECVTTHLPNELALKMDGA 32 >emb|CCD58743.1| unnamed protein product [Schistosoma mansoni] Length = 98 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 106 SAIHFRG*LIRQVSCYTLLSGFRLP*PRLCLIDQ 5 SAIHF+G LIRQVSCYTLLSGFRLP P C +DQ Sbjct: 18 SAIHFQGWLIRQVSCYTLLSGFRLPWPPSCCLDQ 51 >ref|XP_002488947.1| hypothetical protein SORBIDRAFT_1368s002010 [Sorghum bicolor] gi|241947119|gb|EES20264.1| hypothetical protein SORBIDRAFT_1368s002010 [Sorghum bicolor] Length = 85 Score = 40.0 bits (92), Expect(2) = 3e-06 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = -3 Query: 110 VKRHPFSGLVDSAGELLHT 54 ++RHPFSGLVDSAGELLHT Sbjct: 67 LQRHPFSGLVDSAGELLHT 85 Score = 36.6 bits (83), Expect(2) = 3e-06 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 192 SRPGFCSDRRALLLIGAGSCP 130 SRPGFCS RRALLLIGA P Sbjct: 38 SRPGFCSGRRALLLIGAWRSP 58 >gb|ABI52743.1| 10 kDa putative secreted protein [Argas monolakensis] Length = 102 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 26 WSWKSKSAKECVTTHLPNQLAPKMDGA 106 W WK +SAKECVTTHLP QLAPKMDGA Sbjct: 16 WPWKLESAKECVTTHLPKQLAPKMDGA 42